SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_818932.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_818932.1.87134
Domain Number 1 Region: 220-362
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 116-221
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 36-115
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_818932.1.87134
Sequence length 779
Comment band 4.1-like protein 1 isoform b [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVL
FDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQ
LTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSELRF
APNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGV
CANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKR
LWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERSSS
KRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIKEL
KFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKA
NERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTS
SLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGG
IEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTRVSAMDNTQENSLKS
GKGAAAMIPGPQTVATEIRSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSET
RIEKRIIITGDEDVDQDQALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES
Download sequence
Identical sequences NP_001245260.1.87134 NP_001245260.1.92137 NP_818932.1.87134 NP_818932.1.92137 gi|30061491|ref|NP_818932.1| ENSP00000202028 ENSP00000399214 ENSP00000202028 ENSP00000399214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]