SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_835195.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_835195.1.100692
Domain Number 1 Region: 404-676
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.83e-93
Family Inositol polyphosphate kinase (IPK) 0.00000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_835195.1.100692
Sequence length 678
Comment inositol-trisphosphate 3-kinase C [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MRRCPCRGSLSEAEAGALPAEARMGLEALRGGRRRQPGLQRPGPGAGGPTGRPEGGGPRA
WIEGFSLHSEAERTDFGPAPCPDGPQAEPCGDEHEECEAAGLGVASEKPSQNKELDGSNL
QTHPKLSSPLAEMEMAGSWTDGFRTDLHRPDLQARPKRASLCTQPGFDESWTELDRSELW
QTLPERDKPWVDHLRTHQDMSRLQNHPACPSPEPSAGTSCKELSADGSRTPHDTDGFWIE
SQTDGSLIGPSTQTACRQPANDGFSAQDTDGTLIQPGTDDGPWVDSVLEKSNGDDPLMEP
EPRDLVTNLCSHLECSSLCPVPRLIITSESPEPGAQPLGPQARIEGGTGGFSSASSFDES
EDDLVAGGGGTSDPEDRSGSKPWKKLKTVLKYSPFVVSFHKHYYPWVQLSGHAGNFQAGE
DGRILKRFCQCEQRSLELLMGDPLRPFVPTYYGMVQRDGQAFNQMEDLLADFEGPSIMDC
KMGSRTYLEEELVKARERPKPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQWRETLS
STSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVNGDVGILRKYVARLEDLRDT
LENSPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQMLSHRLPWAEGNREDG
YLWGLDNLICLLQGLAQS
Download sequence
Identical sequences Q80ZG2
10116.ENSRNOP00000018696 ENSRNOP00000018696 NP_835195.1.100692 NP_835195.1.4139 ENSRNOP00000018696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]