SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_842565.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_842565.2.92137
Domain Number 1 Region: 25-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.95e-91
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 282-403
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 3 Region: 590-729
Classification Level Classification E-value
Superfamily Spectrin repeat 6.36e-32
Family Spectrin repeat 0.00019
Further Details:      
 
Domain Number 4 Region: 1634-1788
Classification Level Classification E-value
Superfamily Spectrin repeat 9e-30
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 998-1153
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 6 Region: 1210-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 6.7e-28
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 7 Region: 1526-1683
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 1846-2000
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 895-1045
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-27
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 10 Region: 798-938
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 11 Region: 412-515
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 516-624
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-22
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 13 Region: 1371-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-18
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 14 Region: 2005-2066
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000259
Family Spectrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  NP_842565.2.92137
Domain Number - Region: 1156-1229
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0111
Family Spectrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_842565.2.92137
Sequence length 2155
Comment spectrin beta chain, non-erythrocytic 1 isoform 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MELQRTSSISGPLSPAYTGQVPYNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLARVSC
RITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENM
GSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNV
NIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDP
EDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASD
LLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKM
RANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM
RETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENY
HDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLS
QDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRV
AHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSV
MRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLS
AIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEI
ANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYK
MFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIAR
QLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIRE
KTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAI
LSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNT
LTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNE
LHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQED
FMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKD
NRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKI
EKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLD
KWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKST
DEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDH
GHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQL
WGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKK
HQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGK
LDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQE
RVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHD
AKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAA
YAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQ
IEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLL
QLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVE
KLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEA
ESQQQWDTSKGEQVSQNGLPAEQGSPRVSYRSQTYQNYKNFNSRRTASDQPWSGL
Download sequence
Identical sequences A0A2I3TJG7
ENSP00000334156 NP_842565.2.87134 NP_842565.2.92137 XP_008954502.1.60992 XP_016804025.1.37143 ENSP00000334156 gi|112382252|ref|NP_842565.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]