SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_869366.1.48053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_869366.1.48053
Domain Number - Region: 509-569
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000922
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_869366.1.48053
Sequence length 588
Comment sulfate transporter [Rhodopirellula baltica SH 1]; AA=GCF_000196115.1; RF=reference genome; TAX=243090; STAX=265606; NAME=Rhodopirellula baltica SH 1; strain=1; AL=Complete Genome; RT=Major
Sequence
MPAIECVGLCNGRGFHSIRDADFMMNAPSDSSTASMDTPPRGDISGFKRFLKDDLIAGGL
VFLIALPLCLGISLASGFPAIAGVFTAIVGSILTTFLSNSELTIKGPAAGMIVIVLGAVN
SFGYTAGVDPVADMQAYKMALAVGVVAGLVQIAFGLLRAGILGDFFPTAAVHGMLAAIGV
IIMVKQLPIVVGQSASGEPLEILQELPHLLMNANPEIALIGGVSLLILFGLAFLKSRTSD
GFINKIPGPLVVLLVAIPMGMAMNLSSDHTYTLMGKEFTVGESDLVTVPFNLFGAITFPD
FGVFLNSETLPAALGWVLMFALIGSLESLLSAKAVDMLDPHKRKTNLDRDLWAVGVGNMA
ASLIGGLPMISEIVRSKANIDNQAKTRFANMWHGVFLLGFVALLPGLIHNIPRAALAAML
VFTGFRLASPSEFRSVYRVGREQLIIFATTLVAVLATDLLIGIAIGIATKFAIHMINGVP
LRSLFVPTLQFDETSETEVNVHAGDSAVFSNWIGFRRQVVEKSLKQGKNCTVDFSDVHLI
DHSVMEKLHELEGEFAREGIELNVVGMDHHQPFSRHPMAARKRSFVSH
Download sequence
Identical sequences Q7UF60
NP_869366.1.48053 gi|32476372|ref|NP_869366.1| 243090.RB10326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]