SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_892006.3.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_892006.3.92137
Domain Number 1 Region: 12-142,173-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-77
Family Calponin-homology domain, CH-domain 0.0000295
Further Details:      
 
Domain Number 2 Region: 8055-8210
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 8434-8548
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 7835-7959
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-18
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 1626-1761
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-17
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 6974-7115
Classification Level Classification E-value
Superfamily Spectrin repeat 5.47e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 7 Region: 3336-3458
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-16
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 8 Region: 4510-4667
Classification Level Classification E-value
Superfamily Spectrin repeat 1.36e-16
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 9 Region: 7427-7558
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 10 Region: 7088-7232
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000017
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 11 Region: 2462-2592
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000755
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 12 Region: 4292-4448
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000106
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 13 Region: 3764-3885
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000113
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 14 Region: 5050-5208
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 15 Region: 3120-3244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000298
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 16 Region: 7964-8073
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000806
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 17 Region: 6786-6904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000851
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 3892-4006
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000102
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 19 Region: 560-702
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000322
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 2680-2806
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000504
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 21 Region: 7354-7461
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000118
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 22 Region: 3570-3702
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000183
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 23 Region: 7625-7775
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000197
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 24 Region: 5932-6070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000468
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 25 Region: 1408-1542
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000644
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 26 Region: 2834-2951
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000229
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 27 Region: 5734-5811,5922-5968
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 28 Region: 8511-8657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000054
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 29 Region: 2250-2405
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000331
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 30 Region: 4961-5084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000051
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 31 Region: 5476-5595
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000136
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 32 Region: 1091-1229
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000181
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 33 Region: 1926-2077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 34 Region: 5178-5282
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000224
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 35 Region: 1547-1657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000245
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 36 Region: 1716-1867
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000295
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 37 Region: 3486-3596
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000816
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 38 Region: 5600-5690
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 39 Region: 3035-3133
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000576
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 40 Region: 6080-6194
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000157
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 41 Region: 4209-4337
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000216
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 42 Region: 6557-6641
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000252
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 43 Region: 2053-2156
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000445
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 44 Region: 3247-3348
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000547
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 45 Region: 4004-4136
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000756
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 46 Region: 4879-4990
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000955
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 47 Region: 6381-6486
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000127
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 48 Region: 890-1016
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000173
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 49 Region: 2155-2279
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000054
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  NP_892006.3.92137
Domain Number - Region: 4663-4777
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000628
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 6654-6757
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00134
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number - Region: 789-921
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00252
Family Spectrin repeat 0.025
Further Details:      
 
Domain Number - Region: 4141-4237
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number - Region: 5289-5380
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0504
Family Spectrin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_892006.3.92137
Sequence length 8797
Comment nesprin-1 isoform 1 (nesprin-1 giant or enaptin) [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPS
IVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNA
KKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLE
DAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP
GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEM
KRKQIEHLIQPLHRDGKLSLDQALVKQSWDRVTSRLFDWHIQLDKSLPAPLGTIGAWLYR
AEVALREEITVQQVHEETANTIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPD
QLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLL
QNYVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSVE
VRSVRSMLEEVISNWDRYGNTVASLQAWLEDAEKMLNQSENAKKDFFRNLPHWIQQHTAM
NDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEYTDCVVTL
SAFATEAHKKLSEPLEVSFMNVKLLIQDLEDIEQRVPVMDAQYKIITKTAHLITKESPQE
EGKEMFATMSKLKEQLTKVKECYSPLLYESQQLLIPLEELEKQMTSFYDSLGKINEIITV
LEREAQSSALFKQKHQELLACQENCKKTLTLIEKGSQSVQKFVTLSNVLKHFDQTRLQRQ
IADIHVAFQSMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEKGDPEELL
RRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLL
HLKIDVEKNRFLASVEECRTELDRETKLMPQEGSEKIIKEHRVFFSDKGPHHLCEKRLQL
IEELCVKLPVRDPVRDTPGTCHVTLKELRAAIDSTYRKLMEDPDKWKDYTSRFSEFSSWI
STNETQLKGIKGEAIDTANHGEVKRAVEEIRNGVTKRGETLSWLKSRLKVLTEVSSENEA
QKQGDELAKLSSSFKALVTLLSEVEKMLSNFGDCVQYKEIVKNSLEELISGSKEVQEQAE
KILDTENLFEAQQLLLHHQQKTKRISAKKRDVQQQIAQAQQGEGGLPDRGHEELRKLEST
LDGLERSRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELE
QTKEFSKRTESIAVQAENLVKEASEIPLGPQNKQLLQQQAKSIKEQVKKLEDTLEEDIKT
MEMVKTKWDHFGSNFETLSVWITEKEKELNALETSSSAMDMQISQIKVTIQEIESKLSSI
VGLEEEAQSFAQFVTTGESARIKAKLTQIRRYGEELREHAQCLEGTILGHLSQQQKFEEN
LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVV
NRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTWLERGEAKASS
PEMDISADRVKVEGELQLIQALQNEVVSQASFYSKLLQLKESLFSVASKDDVKMMKLHLE
QLDERWRDLPQIINKRINFLQSVVAEHQQFDELLLSFSVWIKLFLSELQTTSEISIMDHQ
VALTRHKDHAAEVESKKGELQSLQGHLAKLGSLGRAEDLHLLQGKAEDCFQLFEEASQVV
ERRQLALSHLAEFLQSHASLSGILRQLRQTVEATNSMNKNESDLIEKDLNDALQNAKALE
SAAVSLDGILSKAQYHLKIGSSEQRTSCRATADQLCGEVERIQNLLGTKQSEADALAVLK
KAFQDQKEELLKSIEDIEERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEHELCWLKD
KAKQIAQKDVAFAPEVDREINRLEVTWDDTKRLIHENQGQCCGLIDLMREYQNLKSAVSK
VLENASSVIVTRTTIKDQEDLKWAFSKHETAKNKMNYKQKDLDNFTSKGKHLLSELKKIH
SSDFSLVKTDMESTVDKWLDVSEKLEENMDRLRVSLSIWDDVLSTRDEIEGWSNNCVPQM
AENISNLDNHLRAEELLKEFESEVKNKALRLEELHSKVNDLKELTKNLETPPDLQFIEAD
LMQKLEHAKEITEVAKGTLKDFTAQSTQVEKFINDITTWFTKVEESLMNCAQNETCEALK
KVKDIQKELQSQQSNISSTQENLNSLCRKYHSAELESLGRAMTGLIKKHEAVSQLCSKTQ
ASLQESLEKHFSESMQEFQEWFLGAKAAAKESSDRTGDSKVLEAKLHDLQNILDSVSDGQ
SKLDAVTQEGQTLYAHLSKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDCASELGSF
EDQHRKLNLWIHEMEERFNTENLGESKQHIPEKKNEVHKVEMFLGELLAARESLDKLSQR
GQLLSEEGHGAGQEGRLCSQLLTSHQNLLRMTKEKLRSCQVALQEHEALEEALQSMWFWV
KAIQDRLACAESTLGSKDTLEKRLSQIQDILLMKGEGEVKLNMAIGKGEQALRSSNKEGQ
RVIQTQLETLKEVWADIMSSSVHAQSTLESVISQWNDYVERKNQLEQWMESVDQKIEHPL
QPQPGLKEKFVLLDHLQSILSEAEDHTRALHRLIAKSRELYEKTEDESFKDTAQEELKTQ
FNDIMTVAKEKMRKVEEIVKDHLMYLDAVHEFTDWLHSAKEELHRWSDMSGDSSATQKKL
SKIKELIDSREIGASRLSRVESLAPEVKQNTTASGCELMHTEMQALRADWKQWEDSVFQT
QSCLENLVSQMALSEQEFSGQVAQLEQALEQFSALLKTWAQQLTLLEGKNTDEEIVECWH
KGQEILDALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYNCLCLQASKGCQN
KEQILQQRFRKAFRDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLSESENGQHK
LNMMLSKGELLSTLLTKEKAKGIQAKVTAAKEDWKNFHSNLHQKESALENLKIQMKDFEV
SAEPIQDWLSKTEKMVHESSNRLYDLPAKRREQQKLQSVLEEIHCYEPQLNRLKEKAQQL
WEGQAASKSFRHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQDWMTDAI
HMLDSYCHPTSDKSVLDSRTLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSPEGIPTIQ
QQLQSVKDMWASLLSAGIRCKSQLEGALSKWTSYQDGVRQFSGWMDSMEANLNESERQHA
ELRDKTTMLGKAKLLNEEVLSYSSLLETIEVKGAGMTEHYVTQLELQDLQERYRAIQERA
KEAVTKSEKLVRLHQEYQRDLKAFEVWLGQEQEKLDQYSVLEGDAHTHETTLRDLQELQV
HCAEGQALLNSVLHTREDVIPSGIPQAEDRALESLRQDWQAYQHRLSETRTQFNNVVNKL
RLMEQKFQQVDEWLKTAEEKVSPRTRRQSNRATKEIQLHQMKKWHEEVTAYRDEVEEVGA
RAQEILDESHVNSRMGCQATQLTSRYQALLLQVLEQIKFLEEEIQSLEESESSLSSYSDW
YGSTHKNFKNVATKIDKVDTVMMGKKLKTLEVLLKDMEKGHSLLKSAREKGERAVKYLEE
GEAERLRKEIHDHMEQLKELTSTVRKEHMTLEKGLHLAKEFSDKCKALTQWIAEYQEILH
VPEEPKMELYEKKAQLSKYKSLQQTVLSHEPSVKSVREKGEALLELVQDVTLKDKIDQLQ
SDYQDLCSIGKEHVFSLEAKVKDHEDYNSELQEVEKWLLQMSGRLVAPDLLETSSLETIT
QQLAHHKAMMEEIAGFEDRLNNLQMKGDTLIGQCADHLQAKLKQNVHAHLQGTKDSYSAI
CSTAQRMYQSLEHELQKHVSRQDTLQQCQAWLSAVQPDLEPSPQPPLSRAEAIKQVKHFR
ALQEQARTYLDLLCSMCDLSNASVKTTAKDIQQTEQTIEQKLVQAQNLTQGWEEIKHLKS
ELWIYLQDADQQLQNMKRRHSELELNIAQNMVSQVKDFVKKLQSKQASVNTIIEKVNKLT
KKEESPEHKEINHLNDQWLDLCRQSNNLCLQREEDLQRTRDYHDCMNVVEVFLEKFTTEW
DNLARSDAESTAVHLEALKKLALALQERKYAIEDLKDQKQKMIEHLNLDDKELVKEQTSH
LEQRWFQLEDLIKRKIQVSVTNLEELNVVQSRFQELMEWAEEQQPNIAEALKQSPPPDMA
QNLLMDHLAICSELEAKQMLLKSLIKDADRVMADLGLNERQVIQKALSDAQSHVNCLSDL
VGQRRKYLNKALSEKTQFLMAVFQATSQIQQHERKIMFREHICLLPDDVSKQVKTCKSAQ
ASLKTYQNEVTGLWAQGRELMKEVTEQEKSEVLGKLQELQSVYDSVLQKCSHRLQELEKN
LVSRKHFKEDFDKACHWLKQADIVTFPEINLMNESSELHTQLAKYQNILEQSPEYENLLL
TLQRTGQTILPSLNEVDHSYLSEKLNALPRQFNVIVALAKDKFYKVQEAILARKEYASLI
ELTTQSLSELEAQFLRMSKVPTDLAVEEALSLQDGCRAILDEVAGLGEAVDELNQKKEGF
RSTGQPWQPDKMLHLVTLYHRLKRQTEQRVSLLEDTTSAYQEHEKMCQQLERQLKSVKEE
QSKVNEETLPAEEKLKMYHSLAGSLQDSGIVLKRVTIHLEDLAPHLDPLAYEKARHQIQS
WQGELKLLTSAIGETVTECESRMVQSIDFQTEMSRSLDWLRRVKAELSGPVYLDLNLQDI
QEEIRKIQIHQEEVQSSLRIMNALSHKEKEKFTKAKELISADLEHSLAELSELDGDIQEA
LRTRQATLTEIYSQCQRYYQVFQAANDWLEDAQELLQLAGNGLDVESAEENLKSHMEFFS
TEDQFHSNLEELHSLVATLDPLIKPTGKEDLEQKVASLELRSQRMSRDSGAQVDLLQRCT
AQWHDYQKAREEVIELMNDTEKKLSEFSLLKTSSSHEAEEKLSEHKALVSVVNSFHEKIV
ALEEKASQLEKTGNDASKATLSRSMTTVWQRWTRLRAVAQDQEKILEDAVDEWTGFNNKV
KKATEMIDQLQDKLPGSSAEKASKAELLTLLEYHDTFVLELEQQQSALGMLRQQTLSMLQ
DGAAPTPGEEPPLMQEITAMQDRCLNMQEKVKTNGKLVKQELKDREMVETQINSVKCWVQ
ETKEYLGNPTIEIDAQLEELQILLTEATNHRQNIEKMAEEQKEKYLGLYTILPSELSLQL
AEVALDLKIRDQIQDKIKEVEQSKATSQELSRQIQKLAKDLTTILTKLKAKTDNVVQAKT
DQKVLGEELDGCNSKLMELDAAVQKFLEQNGQLGKPLAKKIGKLTELHQQTIRQAENRLS
KLNQAASHLEEYNEMLELILKWIEKAKVLAHGTIAWNSASQLREQYILHQTLLEESKEID
SELEAMTEKLQYLTSVYCTEKMSQQVAELGRETEELRQMIKIRLQNLQDAAKDMKKFEAE
LKKLQAALEQAQATLTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVQAVQLCQSALRIPE
DVVASLPLCHAALRLQEEASRLQHTAIQQCNIMQEAVVQYEQYEQEMKHLQQLIEGAHRE
IEDKPVATSNIQELQAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTE
VEGLAEGTEDLDGELLPTPSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACR
SPSPVANTDASVNQDIAYYQALSAERLQTDAAKIHPSTSASQEFYEPGLEPSATAKLGDL
QRSWETLKNVISEKQRTLYEALERQQKYQDSLQSISTKMEAIELKLSESPEPGRSPESQM
AEHQALMDEILMLQDEINELQSSLAEELVSESCEADPAEQLALQSTLTVLAERMSTIRMK
ASGKRQLLEEKLNDQLEEQRQEQALQRYRCEADELDSWLLSTKATLDTALSPPKEPMDME
AQLMDCQNMLVEIEQKVVALSELSVHNENLLLEGKAHTKDEAEQLAGKLRRLKGSLLELQ
RALHDKQLNMQGTAQEKEESDVDLTATQSPGVQEWLAQARTTWTQQRQSSLQQQKELEQE
LAEQKSLLRSVASRGEEILIQHSAAETSGDAGEKPDVLSQELGMEGEKSSAEDQMRMKWE
SLHQEFSTKQKLLQNVLEQEQEQVLYSRPNRLLSGVPLYKGDVPTQDKSAVTSLLDGLNQ
AFEEVSSQSGGAKRQSIHLEQKLYDGVSATSTWLDDVEERLFVATALLPEETETCLFNQE
ILAKDIKEMSEEMDKNKNLFSQAFPENGDNRDVIEDTLGCLLGRLSLLDSVVNQRCHQMK
ERLQQILNFQNDLKVLFTSLADNKYIILQKLANVFEQPVAEQIEAIQQAEDGLKEFDAGI
IELKRRGDKLQVEQPSMQELSKLQDMYDELMMIIGSRRSGLNQNLTLKSQYERALQDLAD
LLETGQEKMAGDQKIIVSSKEEIQQLLDKHKEYFQGLESHMILTETLFRKIISFAVQKET
QFHTELMAQASAVLKRAHKRGVELEYILETWSHLDEDQQELSRQLEVVESSIPSVGLVEE
NEDRLIDRITLYQHLKSSLNEYQPKLYQVLDDGKRLLISISCSDLESQLNQLGECWLSNT
NKMSKELHRLETILKHWTRYQSESADLIHWLQSAKDRLEFWTQQSVTVPQELEMVRDHLN
AFLEFSKEVDAQSSLKSSVLSTGNQLLRLKKVDTATLRSELSRIDSQWTDLLTNIPAVQE
KLHQLQMDKLPSRHAISEVMSWISLMENVIQKDEDNIKNSIGYKAIHEYLQKYKGFKIDI
NCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQILQGLVTEKIQLLEGL
LESWSEYENNVQCLKTWFETQEKRLKQQHRIGDQASVQNALKDCQDLEDLIKAKEKEVEK
IEQNGLALIQNKKEDVSSIVMSTLRELGQTWANLDHMVGQLKILLKSVLDQWSSHKVAFD
KINSYLMEARYSLSRFRLLTGSLEAVQVQVDNLQNLQDDLEKQERSLQKFGSITNQLLKE
CHPPVTETLTNTLKEVNMRWNNLLEEIAEQLQSSKALLQLWQRYKDYSKQCASTVQQQED
RTNELLKAATNKDIADDEVATWIQDCNDLLKGLGTVKDSLFFLHELGEQLKQQVDASAAS
AIQSDQLSLSQHLCALEQALCKQQTSLQAGVLDYETFAKSLEALEAWIVEAEEILQGQDP
SHSSDLSTIQERMEELKGQMLKFSSMAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLI
SSQTTERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELF
QAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDS
QIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDEVQFKEKVFLRQQGS
YILTVEAGKQLLLSADSGAEAALQAELAEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEK
GIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLSLLKDTLSA
YISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEKNKELCEWLTQME
SKVSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLG
KVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSE
EIQRKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRW
RNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSSGVIYTVAKEELK
KFEAFQRQVHECLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQRWDNLQKRVTSIL
RRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNH
NKIEQIIAQGEQLIEKSEPLDAAIIEEELDELRRYCQEVFGRVERYHKKLIRLPLPDDEH
DLSDRELELEDSAALSDLHWHDRSADSLLSPQPSSNLSLSLAQPLRSERSGRDTPASVDS
IPLEWDHDYDLSRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGK
ALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEES
LPGFVNLHSTETQTAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLNSIWAWLGDTE
EELEQLQRLELSTDIQTIELQIKKLKELQKAVDHRKAIILSINLCSPEFTQADSKESRDL
QDRLSQMNGRWDRVCSLLEEWRGLLQDALMQCQGFHEMSHGLLLMLENIDRRKNEIVPID
SNLDAEILQDHHKQLMQIKHELLESQLRVASLQDMSCQLLVNAEGTDCLEAKEKVHVIGN
RLKLLLKEVSRHIKELEKLLDVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQKTPR
GKCSLSQPGPSVSSPHSRSTKGGSDSSLSEPGPGRSGRGFLFRVLRAALPLQLLLLLLIG
LACLVPMSEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences Q8NF91
ENSP00000356224 NP_892006.3.87134 NP_892006.3.92137 ENSP00000356224 gi|330688408|ref|NP_892006.3| ENSP00000356226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]