SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_899205.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_899205.1.92137
Domain Number 1 Region: 21-142
Classification Level Classification E-value
Superfamily EF-hand 2.42e-38
Family EF-hand modules in multidomain proteins 0.0057
Further Details:      
 
Domain Number 2 Region: 144-236
Classification Level Classification E-value
Superfamily EF-hand 1.07e-31
Family EF-hand modules in multidomain proteins 0.0025
Further Details:      
 
Domain Number 3 Region: 219-300
Classification Level Classification E-value
Superfamily RING/U-box 8e-20
Family ZZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_899205.1.92137
Sequence length 560
Comment dystrobrevin beta isoform 5 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIE
AFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYD
SEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTA
VFEGPSFGYTEHSVRTCFPQQRKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHP
VECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEHSSWKSPAKKLS
HAISKSLGCVPTREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHMSSGVPTPTKS
VLDSPSRLDEEHRLIARYAARLAAEAGNVTRPPTDLSFNFDANKQQRQLIAELENKNREI
LQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQL
EELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFA
QAEEGAEEEEEKMQNGKDRG
Download sequence
Identical sequences gi|37577097|ref|NP_899205.1| ENSP00000384787 NP_899205.1.87134 NP_899205.1.92137 ENSP00000384787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]