SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_923587.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_923587.1.44878
Domain Number 1 Region: 71-399
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.57e-62
Family Integrin alpha N-terminal domain 0.0082
Further Details:      
 
Domain Number 2 Region: 407-483
Classification Level Classification E-value
Superfamily E set domains 4.76e-18
Family E-set domains of sugar-utilizing enzymes 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_923587.1.44878
Sequence length 485
Comment hypothetical protein gll0641 [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MNASLPAGASSAACTPFQKVLPTILKMVCLRSQAVRLVGFGLAATVALSAAPVQAQVGFA
PAQTFGVGTTPRGLAIGDLDGDGRIDIVTANIGNNTLSALLGGGDGTFGDLQNYPVGSSP
RAATLADLNGDGDLDAITANGGSGNLSVLRGNGDGTFAAAVNYPVNGTFPAAVAAGDLDG
DGDLDLVSTNRYSENISLLSNNGNGTFGAPRNLVLPPGPSSVVIVDLDEDSDPDLVVGNL
FSANVSVLLNNGNGTFAAPRNYAAASGTSAVGMGDLDGDGDLDLTAVNRFADNVSVMLGN
GNGTFGATRNFAVGDYPVALAIGDLDENGDLDLVTANRRDAGNVSVLPGNGSGGFTAALT
FATGGDGATGVEAGDFDGDGDLDLAVANGFASNVGVLINTGDGVVLPVIDSITPRRGPVG
TEVTITGTGFTGTTAVTFGGASAAFTVISGTQITAIVPAGATSGPIAVTTPAGTATSARR
FRVTS
Download sequence
Identical sequences Q7NMX4
gi|37520210|ref|NP_923587.1| NP_923587.1.44878 251221.gll0641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]