SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_924794.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_924794.1.44878
Domain Number 1 Region: 140-338
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.14e-52
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000105
Further Details:      
 
Domain Number 2 Region: 425-555
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00003
Further Details:      
 
Domain Number 3 Region: 3-139
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.01e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.012
Further Details:      
 
Domain Number 4 Region: 340-417
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00000000000000146
Family Duplicated SiR/NiR-like domains 1 and 3 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_924794.1.44878
Sequence length 560
Comment sulfite reductase subunit beta [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MTDTMRRSKVEQIKENSHNLRGRLREELQQPETTHFAEESVQLLKFHGIYQQDDRDERKA
RKDAGLEPDYAFMVRTKNPGGYAPAAFYLAMDRLADALGSGTLRVTTRQGLQLHGIRKHN
LREAIATISTQLGSTLGACGDINRNVMAPPAPFTARPYAVAREAAAAIADMLTPHTGAYF
EVWQDEALVYSGEPEVEPIYGETYLPRKFKIAVAVEGDNSVDIYTQDLGVIPVFEDGERL
LGYNLTVGGGLGMTHAKPETFPRQADHLGFVSSEDMLEAVKAVVLVQRDHGDRYNRRHAR
LKYLIHDRGLGWFRAQVETYLGKPLQPWRTVAPWVFHDYLGWQPQGDGRYCLGIWIENGR
IKDEGAFRLKSALREIVERFEVDLILTPTQNALLVDVAPEVRAPIDAILQSAGVRPVQAV
SNAERYAMACPAWPTCGLALTESERALPGIIAELEAKLTELDLAQEQISIRMTGCPNGCA
RPYMGEIGFVGSAPGAYNLYLGGNLASTRLNWVFRERVKREDILAVLGPLFSYFKRERAP
GESFGDFCLRKGRADLEAHL
Download sequence
Identical sequences Q7NJI4
NP_924794.1.44878 251221.gvip254 gi|37521417|ref|NP_924794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]