SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_926006.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_926006.1.44878
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.11e-19
Family Ribosomal protein L33p 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_926006.1.44878
Sequence length 63
Comment 50S ribosomal protein L33 [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MAKPGARIIITLECTECRTNTAKRRPGVSRYTTTKNKRNTTGRMELKKFCPNCNKHTVHK
ETK
Download sequence
Identical sequences Q7NCB9
NP_926006.1.44878 gi|37522629|ref|NP_926006.1| 251221.gvip419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]