SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_926628.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_926628.1.44878
Domain Number 1 Region: 127-315
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.42e-52
Family ATP-binding domain of peptide synthetases 0.0000389
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.47e-33
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_926628.1.44878
Sequence length 324
Comment glutathione synthetase [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MKILFIVDPLETLKPGHDTSVALMQAAARRGHSVWAAEVGDLQVHHHRAAAQVRTLTIHP
GRTPFYTVEAVGFYPLSEADVIWMRKDPPVTSAYLWATQVLDLVNAGRGDGRTTFVLNRP
SGLRNDNEKLYALHFPDLVPETRVCTHRQDILDFVDIHGRAVIKPLDGKGGEGIFLLARA
DRNLNAIIEASTAYGTRHVMVQRYLEESRQGDKRIVLLAGEPIGALLRVPREDDVRGNMA
AGGRVVKTTLTERDREICRVVGPRLVADGHYFVGIDVIGAYLTEINVTSPTGICEIDVLD
GVVLEDEIVDWLVEYTRPALARNL
Download sequence
Identical sequences Q7NF44
NP_926628.1.44878 251221.gvip498 gi|37523251|ref|NP_926628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]