SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_957003.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_957003.1.45394
Domain Number 1 Region: 89-183
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-29
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 9-65
Classification Level Classification E-value
Superfamily L27 domain 1.68e-22
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_957003.1.45394
Sequence length 218
Comment protein lin-7 homolog A [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MATVTVQPLTLERDVTRAIELLEKLQESGDVPGHKLQSLKKVLQSEFCTAIREVYQYMHE
TITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYI
SRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLE
EMEARFEKLRTARRRQQQQILMQQQQQQNLAAQQNHMS
Download sequence
Identical sequences Q6PC63
ENSDARP00000022617 ENSDARP00000022617 7955.ENSDARP00000022617 NP_957003.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]