SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_974313.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_974313.1.80155
Domain Number 1 Region: 139-217
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.66e-16
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_974313.1.80155
Sequence length 343
Comment RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MDAQYQDLPPLKRLRLLQRDLEAAQQHQLPNQPEMKSLQLPAKKRKQTRVDYDDDDAENS
NPTYHCLPAKKRIWAIDPDLLSGGGNPFSPFDLNVEYKPYVEEKSIEKKSTLNVESSLEV
EEDDDKENIDPLGKGKALDLSDREVEDEDGIMCAVCQSTDGDPLNPIVFCDGCDLMVHAS
CYGNPLVKAIPEGDWFCRQCLSSKNREKIFSCCLCTTKGGAMKPTNDGRWAHITCALFVP
EVYFEDPEGREGICCSEVLSKRWKDRCYLCKVRRGCVIECSEMRCKLAFHVTCGLKEDLC
IEYREGKKSGGIVVGFCNEHTKLWERQQESGKYKIVAREEDKK
Download sequence
Identical sequences A0A178VIT7 Q9LUC1
3702.AT3G14740.2-P AT3G14740.2 NP_974313.1.80155 AT3G14740.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]