SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_982639.1.49492 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_982639.1.49492
Domain Number 1 Region: 12-393
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.52e-109
Family IF2B-like 0.00000000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_982639.1.49492
Sequence length 403
Comment AAR098Wp [Eremothecium gossypii ATCC 10895]; AA=GCF_000091025.4; RF=representative genome; TAX=284811; STAX=33169; NAME=Eremothecium gossypii ATCC 10895; strain=ATCC 10895; AL=Complete Genome; RT=Major
Sequence
MSLQAIQFQRGDKSQVSVRVLDQLLLPYVSRYIPIQTVDDGFAVIRSMQVRGAPAIAIVG
VLSVLVECQLLCNEDFVAVQAFYDLSSYAAFGRTMRMRLAHLLGSRPTAVNLSHALRDVE
RLLDSATSLSQFRDRMYDYACELLDMDVANNVRMGDNGARFLLDALIAEGFDGSFAVLTI
CNTGSLATAGYGTALGAIRSLWQHAEAGLTAPKKQKASACAPRMTHVFPLETRPYNQGSR
LTAYELLHDAIPATLITDSSVAYRIQTSPVPIKAAFVGADRIARNGDTANKIGTLQLALV
CRHFGIRFFVVAPRSTVDGTTAAGTDIPVEERCPDEFRVVTGAAAGATGDPTTASVAIAP
RDMPVWNPAFDVTPHAYIDAIVTETRVFTKDAAGNFDLDELFT
Download sequence
Identical sequences Q75EI1
NP_982639.1.49492 33169.AGOS_AAR098W tr|Q75EI1|Q75EI1_ASHGO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]