SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_995615.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_995615.2.81976
Domain Number 1 Region: 505-851
Classification Level Classification E-value
Superfamily TPR-like 2.19e-37
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_995615.2.81976
Sequence length 859
Comment uncharacterized protein Dmel_CG31690 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MHTPKCRRPSMSATLSHKDLAGLAGCSALAFVLYLNTLNAGFVYDDRRAILANGDVTGAR
PLANLLRNDFWGTPLVDSGSHGSWRPLCVLSFRLNYLAGGMTPLGYHLVNVMLHCVATWL
VFLVARTLLPSRMGVLAAGALFAVHPAHTEAVAGLVGRADLASCVCYLLAYLSYRRHMLN
REWGSLILTIMLALAALLCKETAITALLLCGLCDVLSPVGRENSDKVCDGSISGLASFNF
QRRFRSLSILGFTLLCGLYCRLSLLPRPSTAFSAADNPTAHESCFWTRTLTFLYLPVANF
GILLWPQELSFDWGMEAVSRIRTLWDARNILTAGFYGSLVAILWKGSGLRSAASPMDFAE
VANISLPLLRRLGGNSCHTWLGLTCDCHHQLSAPSYRSASAIYSTSSKSKSASWTAAPIL
GTAFLVLPFLPASNLLFYVGFVMAERVLYLPSVGYCLLFGLGFGHLWQRVNSSWRSRLML
LCGLALLLGVHGVRTFRRNLDWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELT
LRMTLGHRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLG
DHRQEAISVLRTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALRESLK
ALPLLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYGQTLARNGS
RLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYTLQSCV
ADALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPG
HAISRANLARMNVHKHENE
Download sequence
Identical sequences Q9VQE9 T2GG64
FBpp0290896 NP_995615.2.81976 FBpp0290896 FBpp0290896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]