SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_997217.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_997217.1.92137
Domain Number 1 Region: 59-211
Classification Level Classification E-value
Superfamily PH domain-like 5.6e-23
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_997217.1.92137
Sequence length 329
Comment protein FAM43B [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MLPWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRR
QKVELNKEDPTYTVWYLGNAVTLHAKGDGCTDDAVGKIWARCGPGGGTKMKLTLGPHGIR
MQPCERSAAGGSGGRRPAHAYLLPRITYCTADGRHPRVFAWVYRHQARHKAVVLRCHAVL
LARAHKARALARLLRQTALAAFSDFKRLQRQSDARHVRQQHLRAGGAAASVPRAPLRRLL
NAKCAYRPPPSERSRGAPRLSSIQEEDEEEEEDDAEEQEGGVPQRERPEVLSLARELRTC
SLRGAPAPPPPAQPRRWKAGPRERAGQAR
Download sequence
Identical sequences K7AQ56 Q6ZT52
gi|46409306|ref|NP_997217.1| 9606.ENSP00000331397 ENSP00000331397 ENSP00000331397 NP_997217.1.87134 NP_997217.1.92137 XP_513169.3.37143 ENSP00000331397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]