SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_997716.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_997716.1.87134
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000249
Family LysM domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_997716.1.87134
Sequence length 227
Comment lysM and putative peptidoglycan-binding domain-containing protein 1 isoform a [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHS
TERKKQETGAGRANGEVLPTPGQETPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGE
NGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences Q96S90
ENSP00000357904 gi|47086487|ref|NP_997716.1| ENSP00000357904 ENSP00000357904 NP_997716.1.87134 NP_997716.1.92137 XP_008968675.1.60992 9606.ENSP00000357904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]