SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000104051.1.4964 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000104051.1.4964
Domain Number 1 Region: 60-323
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.9e-81
Family L-arabinose binding protein-like 0.000016
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.04e-18
Family GalR/LacI-like bacterial regulator 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000104051.1.4964
Sequence length 323
Comment MULTISPECIES: LacI family transcriptional regulator [Bacillus cereus group]; AA=GCF_000161355.1; RF=na; TAX=526991; STAX=1396; NAME=Bacillus cereus AH676; strain=AH676; AL=Chromosome; RT=Major
Sequence
MSTIKDVAKLAGVSVATVSRVLNKNGYVHEDTLKKVERAIEMLDYKPSTVARSLYNKKSR
LIGLVVPNIVNPFFPEVARAVEDVAHKQGYTVVLCNSDESLEKEKQYIDVLRQNNVDGFI
VATNPQNSVNYMNLSVPVVAIDRMFNERIPTVYADNYAGSQAATKLLLDKGCKHIAHIRG
PRDVSTANERFEGFVDVITQNNLSYMIAESTFEPANSERVAMELLEEYPHIDGIVAGNDL
IAIGIVKAALQKGIAIPDDLQIIGFDGISLTEMMYPSITTVAQPIYEMGKIATELLLEQM
EGNTLEEKHYRLPIEIIERNTTK
Download sequence
Identical sequences A0A0G4D6I1 A0A0K0Q7J7 A0A0U0NVM9 A0A164U7G8 A0A1I4MQF3 A0A229M8B7 A0A243DZ10 A0A243F1Y1 A0A243K5D8 A0A243LWF5 A0A2A2PD97 C2SWB7 C2U9D5 J8HI54 J8LDR2 J8N1R7 Q81HX1 R8GYH1
226900.BC0659 gi|296501416|ref|YP_003663116.1| NP_830473.1.86172 WP_000104051.1.100912 WP_000104051.1.11521 WP_000104051.1.1354 WP_000104051.1.14006 WP_000104051.1.14174 WP_000104051.1.20208 WP_000104051.1.20651 WP_000104051.1.21055 WP_000104051.1.22699 WP_000104051.1.24680 WP_000104051.1.25290 WP_000104051.1.26513 WP_000104051.1.26637 WP_000104051.1.32784 WP_000104051.1.33201 WP_000104051.1.41518 WP_000104051.1.44956 WP_000104051.1.4964 WP_000104051.1.51072 WP_000104051.1.54240 WP_000104051.1.54547 WP_000104051.1.54736 WP_000104051.1.55116 WP_000104051.1.56320 WP_000104051.1.58822 WP_000104051.1.60153 WP_000104051.1.64282 WP_000104051.1.64568 WP_000104051.1.65803 WP_000104051.1.67001 WP_000104051.1.67912 WP_000104051.1.68562 WP_000104051.1.69347 WP_000104051.1.71114 WP_000104051.1.73396 WP_000104051.1.73790 WP_000104051.1.74651 WP_000104051.1.7534 WP_000104051.1.75891 WP_000104051.1.76902 WP_000104051.1.80126 WP_000104051.1.80649 WP_000104051.1.86637 WP_000104051.1.87768 WP_000104051.1.88154 WP_000104051.1.88200 WP_000104051.1.93683 WP_000104051.1.93838 WP_000104051.1.9533 WP_000104051.1.97262 WP_000104051.1.97842 WP_000104051.1.98315 WP_000104051.1.98604 gi|30018842|ref|NP_830473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]