SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000159986.1.96943 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000159986.1.96943
Domain Number 1 Region: 51-227
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.62e-30
Family B3/B4 domain of PheRS, PheT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000159986.1.96943
Sequence length 234
Comment MULTISPECIES: hypothetical protein [Streptococcus]; AA=GCF_001016115.1; RF=na; TAX=1311; STAX=1311; NAME=Streptococcus agalactiae; strain=418849; AL=Contig; RT=Major
Sequence
MTKFIVDSSYWNLFPTSKIGVILIKDYHMDRNLETELKQLLSDSYSLAKKYLQEKEFSQN
RVIQTYRKAYQTFKTKKGARSSIEALLKRVNSGNEITSINPLVDIYNAASLRFGLPIGAE
DSDTFSGDLKLTITNGGDEFYLIGEDFNRPTLSGELAYVDDVGAVCRCFNWRDGKRTMIT
DNTQNAFLVIELINNRREIIFKEALDFIATNTNRFLNAKTQTIILDKEHSEITL
Download sequence
Identical sequences A0A0H1J7W5
gi|406710474|ref|YP_006765200.1| gi|76786742|ref|YP_330710.1| WP_000159986.1.100367 WP_000159986.1.100766 WP_000159986.1.101222 WP_000159986.1.101267 WP_000159986.1.10371 WP_000159986.1.11465 WP_000159986.1.12166 WP_000159986.1.12688 WP_000159986.1.12755 WP_000159986.1.12978 WP_000159986.1.13064 WP_000159986.1.1437 WP_000159986.1.15526 WP_000159986.1.16134 WP_000159986.1.16535 WP_000159986.1.1760 WP_000159986.1.18450 WP_000159986.1.18841 WP_000159986.1.18933 WP_000159986.1.19892 WP_000159986.1.20188 WP_000159986.1.21525 WP_000159986.1.22004 WP_000159986.1.23380 WP_000159986.1.24441 WP_000159986.1.24475 WP_000159986.1.26791 WP_000159986.1.27880 WP_000159986.1.29163 WP_000159986.1.29238 WP_000159986.1.29352 WP_000159986.1.30703 WP_000159986.1.30710 WP_000159986.1.3074 WP_000159986.1.31888 WP_000159986.1.32728 WP_000159986.1.34276 WP_000159986.1.34467 WP_000159986.1.34475 WP_000159986.1.36095 WP_000159986.1.36408 WP_000159986.1.36726 WP_000159986.1.36878 WP_000159986.1.36977 WP_000159986.1.39386 WP_000159986.1.3963 WP_000159986.1.41399 WP_000159986.1.41663 WP_000159986.1.41785 WP_000159986.1.42844 WP_000159986.1.44727 WP_000159986.1.44746 WP_000159986.1.45 WP_000159986.1.45103 WP_000159986.1.45150 WP_000159986.1.45976 WP_000159986.1.47485 WP_000159986.1.48239 WP_000159986.1.5055 WP_000159986.1.50639 WP_000159986.1.51114 WP_000159986.1.51780 WP_000159986.1.52401 WP_000159986.1.52470 WP_000159986.1.54818 WP_000159986.1.56404 WP_000159986.1.56602 WP_000159986.1.56930 WP_000159986.1.57721 WP_000159986.1.57900 WP_000159986.1.59565 WP_000159986.1.5977 WP_000159986.1.61267 WP_000159986.1.61790 WP_000159986.1.62362 WP_000159986.1.63764 WP_000159986.1.64459 WP_000159986.1.64468 WP_000159986.1.64713 WP_000159986.1.65323 WP_000159986.1.67008 WP_000159986.1.67759 WP_000159986.1.68827 WP_000159986.1.69023 WP_000159986.1.69101 WP_000159986.1.69132 WP_000159986.1.70286 WP_000159986.1.70397 WP_000159986.1.71554 WP_000159986.1.73137 WP_000159986.1.75293 WP_000159986.1.7586 WP_000159986.1.76610 WP_000159986.1.79135 WP_000159986.1.80180 WP_000159986.1.81115 WP_000159986.1.81168 WP_000159986.1.81506 WP_000159986.1.82501 WP_000159986.1.8340 WP_000159986.1.83616 WP_000159986.1.84119 WP_000159986.1.84227 WP_000159986.1.85179 WP_000159986.1.852 WP_000159986.1.87033 WP_000159986.1.87307 WP_000159986.1.87395 WP_000159986.1.87807 WP_000159986.1.87882 WP_000159986.1.88296 WP_000159986.1.887 WP_000159986.1.89248 WP_000159986.1.89303 WP_000159986.1.90411 WP_000159986.1.90530 WP_000159986.1.90666 WP_000159986.1.90941 WP_000159986.1.91002 WP_000159986.1.933 WP_000159986.1.93323 WP_000159986.1.9386 WP_000159986.1.94370 WP_000159986.1.95950 WP_000159986.1.96087 WP_000159986.1.96943 WP_000159986.1.97836 WP_000159986.1.97850 WP_000159986.1.99241 205921.SAK_2120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]