SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000211759.1.18588 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000211759.1.18588
Domain Number 1 Region: 138-415
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.11e-84
Family D-glucarate dehydratase-like 0.00000000403
Further Details:      
 
Domain Number 2 Region: 7-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.6e-32
Family Enolase N-terminal domain-like 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000211759.1.18588
Sequence length 446
Comment MULTISPECIES: glucarate dehydratase-related protein [Enterobacteriaceae]; AA=GCF_002109875.1; RF=na; TAX=656430; STAX=562; NAME=Escherichia coli TA008; strain=TA008; AL=Scaffold; RT=Major
Sequence
MTTQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDNAGHTGIGEAPGGEVI
YQTLVDAIPMVLGQEVARLNKVVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALL
DLLGKALNVPVCELLGPGKQRETITVLGYLFYIGDRTKTDLPYLENTPGNHEWYQLRHQK
AMNSEAVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWL
LDEAISLCKGLNDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGN
PTAIDTHWIWQEGDCRLTQNPLEIKNGKIAVPDAPGLGVELDWEQVQKAHEAYKRLPGGA
RNDAGPMQYLIPGWTFDRKRPVFGRH
Download sequence
Identical sequences A0A140N438 A0A142H606 A0A1V3VZT9
331112.EcHS_A2932 413997.ECB_02633 469008.ECBD_0941 gi|253772361|ref|YP_003035192.1| WP_000211759.1.10233 WP_000211759.1.12468 WP_000211759.1.12594 WP_000211759.1.13002 WP_000211759.1.13608 WP_000211759.1.13824 WP_000211759.1.13974 WP_000211759.1.16500 WP_000211759.1.16612 WP_000211759.1.17360 WP_000211759.1.18050 WP_000211759.1.18588 WP_000211759.1.19206 WP_000211759.1.19878 WP_000211759.1.20170 WP_000211759.1.20308 WP_000211759.1.20515 WP_000211759.1.24316 WP_000211759.1.24499 WP_000211759.1.25042 WP_000211759.1.25312 WP_000211759.1.27611 WP_000211759.1.31506 WP_000211759.1.33751 WP_000211759.1.33888 WP_000211759.1.33974 WP_000211759.1.34982 WP_000211759.1.35704 WP_000211759.1.36739 WP_000211759.1.38155 WP_000211759.1.38533 WP_000211759.1.38544 WP_000211759.1.39167 WP_000211759.1.39541 WP_000211759.1.41960 WP_000211759.1.42989 WP_000211759.1.43622 WP_000211759.1.44211 WP_000211759.1.45313 WP_000211759.1.45752 WP_000211759.1.46573 WP_000211759.1.47322 WP_000211759.1.47764 WP_000211759.1.48477 WP_000211759.1.48847 WP_000211759.1.50266 WP_000211759.1.50717 WP_000211759.1.51380 WP_000211759.1.51548 WP_000211759.1.52421 WP_000211759.1.54476 WP_000211759.1.56197 WP_000211759.1.56285 WP_000211759.1.56980 WP_000211759.1.60151 WP_000211759.1.61181 WP_000211759.1.63721 WP_000211759.1.6499 WP_000211759.1.66280 WP_000211759.1.67200 WP_000211759.1.6923 WP_000211759.1.6945 WP_000211759.1.71285 WP_000211759.1.71632 WP_000211759.1.72544 WP_000211759.1.75672 WP_000211759.1.75735 WP_000211759.1.76547 WP_000211759.1.76933 WP_000211759.1.78791 WP_000211759.1.79306 WP_000211759.1.81576 WP_000211759.1.81935 WP_000211759.1.83415 WP_000211759.1.8345 WP_000211759.1.84298 WP_000211759.1.84877 WP_000211759.1.88711 WP_000211759.1.89927 WP_000211759.1.91640 WP_000211759.1.93309 WP_000211759.1.93971 WP_000211759.1.96279 WP_000211759.1.99310 gi|251786062|ref|YP_003000366.1| gi|157162242|ref|YP_001459560.1| gi|251786062|ref|YP_003000366.1| gi|254162714|ref|YP_003045822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]