SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000235803.1.87933 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000235803.1.87933
Domain Number 1 Region: 48-356,437-466
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.11e-62
Family Type II chitinase 0.00022
Further Details:      
 
Domain Number 2 Region: 368-435
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000058
Family Chitinase insertion domain 0.0041
Further Details:      
 
Domain Number 3 Region: 643-697
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000726
Family Carbohydrate binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000235803.1.87933
Sequence length 699
Comment chitinase [Salmonella enterica]; AA=GCF_002065155.1; RF=na; TAX=399587; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Rissen; strain=BCW_2764; AL=Contig; RT=Major
Sequence
MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNKYKNSTTKPKVFGYYT
DWSQYDSRLQGNMSQPGRGYDLTNVSPTAYDKLIFGFVGITGFRKIDKEDRDVVAEAAAQ
CGKVKYEPTFLDPWGDFQSYINLGFETSGWDVDPKTVTQANAKGMLGALRDMQAKAKAAG
HTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFKQFPMFSEVDIDWEYPNDEGA
GNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASAVTTIFDYAKVKDLMAAGLYGI
NLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLLAEGFSADRINIGYAGYTRNA
RQVEIESLSPLKGSYNPGSGPTTGSFESGTSEWYDVIYSYLDLENQKGRNGFNVYTDQVA
DADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVFTWTIDQDNGVLVNAVREGLGYE
IESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNHAPKAAIELLVVGGSTVQLSGAGSSD
EDNDELSFSWGVPSQITVADKTAEIIEVVVPEVSEKTAFQFTLFVRDCYNEPSSQQRFVL
TAVPALSQVQPEPEEEEEIIVPVPDEEEDTTPAEDDTSADDKTSPYAQWDASTVYGANWG
SFEIVSWKGHNYQVKWWSMGDQPDLNCGVGGAWTDLGAY
Download sequence
Identical sequences B5F6Z6
gi|563651623|ref|YP_008859676.1| gi|197248226|ref|YP_002144999.1| CP001138|CDS_17868-19967 WP_000235803.1.10013 WP_000235803.1.100721 WP_000235803.1.100790 WP_000235803.1.100932 WP_000235803.1.10507 WP_000235803.1.10797 WP_000235803.1.11369 WP_000235803.1.11621 WP_000235803.1.12059 WP_000235803.1.12063 WP_000235803.1.12650 WP_000235803.1.13829 WP_000235803.1.14528 WP_000235803.1.15479 WP_000235803.1.15978 WP_000235803.1.16052 WP_000235803.1.16158 WP_000235803.1.16273 WP_000235803.1.16656 WP_000235803.1.16826 WP_000235803.1.17949 WP_000235803.1.18445 WP_000235803.1.18919 WP_000235803.1.19469 WP_000235803.1.20081 WP_000235803.1.20795 WP_000235803.1.22623 WP_000235803.1.23080 WP_000235803.1.23258 WP_000235803.1.23675 WP_000235803.1.24696 WP_000235803.1.24837 WP_000235803.1.25205 WP_000235803.1.25514 WP_000235803.1.26883 WP_000235803.1.272 WP_000235803.1.2723 WP_000235803.1.28002 WP_000235803.1.28267 WP_000235803.1.28811 WP_000235803.1.28977 WP_000235803.1.29732 WP_000235803.1.30331 WP_000235803.1.30696 WP_000235803.1.31155 WP_000235803.1.3278 WP_000235803.1.33659 WP_000235803.1.34084 WP_000235803.1.34881 WP_000235803.1.35835 WP_000235803.1.36229 WP_000235803.1.36885 WP_000235803.1.37021 WP_000235803.1.37147 WP_000235803.1.37158 WP_000235803.1.3728 WP_000235803.1.37610 WP_000235803.1.38055 WP_000235803.1.38113 WP_000235803.1.3828 WP_000235803.1.38995 WP_000235803.1.40910 WP_000235803.1.4109 WP_000235803.1.41265 WP_000235803.1.41308 WP_000235803.1.41593 WP_000235803.1.41628 WP_000235803.1.4184 WP_000235803.1.41862 WP_000235803.1.41931 WP_000235803.1.42453 WP_000235803.1.43676 WP_000235803.1.43828 WP_000235803.1.44359 WP_000235803.1.44453 WP_000235803.1.44636 WP_000235803.1.45134 WP_000235803.1.46358 WP_000235803.1.46637 WP_000235803.1.47460 WP_000235803.1.47614 WP_000235803.1.47767 WP_000235803.1.48751 WP_000235803.1.49214 WP_000235803.1.51036 WP_000235803.1.5114 WP_000235803.1.5125 WP_000235803.1.51704 WP_000235803.1.51910 WP_000235803.1.53315 WP_000235803.1.53814 WP_000235803.1.5392 WP_000235803.1.5415 WP_000235803.1.55166 WP_000235803.1.55803 WP_000235803.1.56004 WP_000235803.1.57076 WP_000235803.1.57344 WP_000235803.1.58131 WP_000235803.1.58239 WP_000235803.1.58416 WP_000235803.1.59006 WP_000235803.1.5929 WP_000235803.1.59979 WP_000235803.1.60503 WP_000235803.1.60622 WP_000235803.1.60760 WP_000235803.1.60863 WP_000235803.1.61732 WP_000235803.1.62144 WP_000235803.1.62693 WP_000235803.1.63690 WP_000235803.1.63860 WP_000235803.1.63866 WP_000235803.1.63912 WP_000235803.1.63958 WP_000235803.1.6451 WP_000235803.1.67814 WP_000235803.1.67969 WP_000235803.1.69554 WP_000235803.1.70003 WP_000235803.1.70169 WP_000235803.1.70327 WP_000235803.1.70733 WP_000235803.1.70761 WP_000235803.1.70899 WP_000235803.1.714 WP_000235803.1.72243 WP_000235803.1.72793 WP_000235803.1.74089 WP_000235803.1.74454 WP_000235803.1.75301 WP_000235803.1.75740 WP_000235803.1.7672 WP_000235803.1.76799 WP_000235803.1.7684 WP_000235803.1.77241 WP_000235803.1.7814 WP_000235803.1.78881 WP_000235803.1.79974 WP_000235803.1.80473 WP_000235803.1.81736 WP_000235803.1.83258 WP_000235803.1.84209 WP_000235803.1.85217 WP_000235803.1.85408 WP_000235803.1.86284 WP_000235803.1.86656 WP_000235803.1.8691 WP_000235803.1.87282 WP_000235803.1.87933 WP_000235803.1.88214 WP_000235803.1.88683 WP_000235803.1.88970 WP_000235803.1.91864 WP_000235803.1.92099 WP_000235803.1.92394 WP_000235803.1.92827 WP_000235803.1.94717 WP_000235803.1.95623 WP_000235803.1.95729 WP_000235803.1.96042 WP_000235803.1.96642 WP_000235803.1.9863 WP_000235803.1.99278 454166.SeAg_B0021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]