SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000397979.1.58822 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000397979.1.58822
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.28e-16
Family PrgX N-terminal domain-like 0.053
Further Details:      
 
Domain Number 2 Region: 111-273
Classification Level Classification E-value
Superfamily TPR-like 0.0000000425
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000397979.1.58822
Sequence length 292
Comment MULTISPECIES: transcriptional regulator [Bacillus]; AA=GCF_000161115.1; RF=na; TAX=526978; STAX=1396; NAME=Bacillus cereus BDRD-Cer4; strain=BDRD-Cer4; AL=Chromosome; RT=Major
Sequence
MEFYNLGIIIKELRKKKNMSQSELCHGICSQSQISKIEKGIIYPSSILLYQLSERLGIDP
NYIFALTKNKKIKYIENVKCVMRDCVKQKQYNELYEIVKKEKDENNFQSKEDKQFLLWHE
AIAIYYVNGATSNAFDILNRALKQTLSSSNFLSEKEISIMNSIAIIHAENEEYEKSINIL
KQSLINFNKIEFPREKEIKLRLIHTLTKCLHLANQYEEAIKYSEIGIKLAINMNTLYLLG
ELFFEKGAILLKVQHSNEVGLTDIKKALFIFELTERKQYIKMIKEKYIKNQE
Download sequence
Identical sequences A0A0D1R1H8 A0A0G4D1J7 A0A0T8G9C2 A0A164QUH2 A0A1M6K9I6 A0A1Q9KPD1 A0A1Y0TIC1 A0A229MJZ7 A0A243DT94 A0A2C9ZBJ7 C2T1C0 C2UDU9 C3E3M5 J8HQX4 J8LPK9 J8M7D7 J8MA14 Q81DC5 R8H9G5
gi|296503031|ref|YP_003664731.1| 226900.BC2443 gi|30020574|ref|NP_832205.1| NP_832205.1.86172 WP_000397979.1.100912 WP_000397979.1.1354 WP_000397979.1.14006 WP_000397979.1.14174 WP_000397979.1.14176 WP_000397979.1.18914 WP_000397979.1.20208 WP_000397979.1.21055 WP_000397979.1.23540 WP_000397979.1.25599 WP_000397979.1.26513 WP_000397979.1.26826 WP_000397979.1.32784 WP_000397979.1.32927 WP_000397979.1.33201 WP_000397979.1.36221 WP_000397979.1.41518 WP_000397979.1.44956 WP_000397979.1.46326 WP_000397979.1.5025 WP_000397979.1.51072 WP_000397979.1.55116 WP_000397979.1.58822 WP_000397979.1.59058 WP_000397979.1.60153 WP_000397979.1.6304 WP_000397979.1.67912 WP_000397979.1.6846 WP_000397979.1.71114 WP_000397979.1.73396 WP_000397979.1.73790 WP_000397979.1.76155 WP_000397979.1.76902 WP_000397979.1.80126 WP_000397979.1.85592 WP_000397979.1.86637 WP_000397979.1.88154 WP_000397979.1.88200 WP_000397979.1.93683 WP_000397979.1.96437 WP_000397979.1.97842 WP_000397979.1.98604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]