SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000446832.1.59310 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000446832.1.59310
Domain Number 1 Region: 133-300
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.05e-29
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.034
Further Details:      
 
Domain Number 2 Region: 58-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000103
Family AraC type transcriptional activator 0.0024
Further Details:      
 
Domain Number 3 Region: 7-56
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000896
Family AraC type transcriptional activator 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000446832.1.59310
Sequence length 300
Comment MULTISPECIES: AraC family transcriptional regulator [Bacillus cereus group]; AA=GCF_000875715.1; RF=na; TAX=1392; STAX=1392; NAME=Bacillus anthracis; strain=A1144; AL=Complete Genome; RT=Major
Sequence
MESYETQIQRSIDYIEEDVMEKQTLRNLARIAGFSESHFHRVFQALVGDTVMEYVRKRRL
ARAAYQLSHTDEKIIDIAFEHGFQSHETFTRAFKKLFQMTPSEYRKQEIETPMYYSVNVK
QRKLNPYLGGIQMEYRIVNKPEFLMAGYELKTTSKEGKNHQDIPAFWQEYLQKDLGTTIP
NRKDTSQWVELGLCTDFNLETGDFTYIIGMEVTDFENVPNEIAKRTFPAATYAVFTTPKV
PHEEMVSSIHQTWNAVFSEWFPHSGYEHCGVNEFELYDERSHADKSEFAQIELWIPVKKK
Download sequence
Identical sequences A0A0F7RMC5 A0A243CS60 Q81TY6
gi|30261224|ref|NP_843601.1| 198094.BA_1114 260799.BAS1036 261594.GBAA1114 592021.BAA_1199 gi|229601641|ref|YP_002865647.1| gi|386734925|ref|YP_006208106.1| NP_843601.1.87267 WP_000446832.1.100214 WP_000446832.1.100409 WP_000446832.1.100595 WP_000446832.1.10208 WP_000446832.1.11427 WP_000446832.1.11676 WP_000446832.1.13115 WP_000446832.1.13233 WP_000446832.1.13820 WP_000446832.1.14721 WP_000446832.1.14855 WP_000446832.1.15460 WP_000446832.1.15569 WP_000446832.1.16170 WP_000446832.1.16997 WP_000446832.1.17146 WP_000446832.1.18976 WP_000446832.1.19258 WP_000446832.1.19445 WP_000446832.1.20390 WP_000446832.1.20680 WP_000446832.1.21258 WP_000446832.1.21776 WP_000446832.1.22865 WP_000446832.1.23269 WP_000446832.1.2419 WP_000446832.1.24334 WP_000446832.1.24556 WP_000446832.1.25716 WP_000446832.1.25752 WP_000446832.1.2618 WP_000446832.1.26665 WP_000446832.1.26721 WP_000446832.1.27644 WP_000446832.1.28427 WP_000446832.1.28729 WP_000446832.1.29787 WP_000446832.1.30110 WP_000446832.1.31490 WP_000446832.1.3236 WP_000446832.1.32576 WP_000446832.1.33175 WP_000446832.1.33338 WP_000446832.1.33367 WP_000446832.1.33740 WP_000446832.1.33876 WP_000446832.1.34646 WP_000446832.1.35684 WP_000446832.1.35886 WP_000446832.1.36305 WP_000446832.1.36763 WP_000446832.1.38036 WP_000446832.1.39781 WP_000446832.1.40550 WP_000446832.1.41165 WP_000446832.1.41675 WP_000446832.1.4439 WP_000446832.1.45305 WP_000446832.1.45533 WP_000446832.1.46236 WP_000446832.1.46699 WP_000446832.1.47145 WP_000446832.1.4763 WP_000446832.1.47644 WP_000446832.1.47798 WP_000446832.1.51749 WP_000446832.1.52794 WP_000446832.1.53137 WP_000446832.1.53493 WP_000446832.1.53683 WP_000446832.1.54189 WP_000446832.1.55811 WP_000446832.1.55958 WP_000446832.1.56176 WP_000446832.1.56270 WP_000446832.1.56959 WP_000446832.1.58160 WP_000446832.1.59095 WP_000446832.1.59310 WP_000446832.1.60402 WP_000446832.1.61213 WP_000446832.1.63560 WP_000446832.1.63611 WP_000446832.1.69894 WP_000446832.1.70065 WP_000446832.1.70996 WP_000446832.1.72704 WP_000446832.1.73325 WP_000446832.1.74226 WP_000446832.1.74538 WP_000446832.1.75499 WP_000446832.1.75870 WP_000446832.1.76125 WP_000446832.1.76783 WP_000446832.1.77668 WP_000446832.1.77824 WP_000446832.1.78644 WP_000446832.1.79315 WP_000446832.1.79584 WP_000446832.1.80439 WP_000446832.1.80695 WP_000446832.1.81799 WP_000446832.1.82289 WP_000446832.1.83951 WP_000446832.1.84045 WP_000446832.1.85689 WP_000446832.1.86119 WP_000446832.1.86140 WP_000446832.1.86239 WP_000446832.1.86288 WP_000446832.1.8698 WP_000446832.1.8825 WP_000446832.1.90883 WP_000446832.1.9186 WP_000446832.1.92686 WP_000446832.1.92831 WP_000446832.1.93271 WP_000446832.1.93744 WP_000446832.1.94237 WP_000446832.1.94322 WP_000446832.1.94784 WP_000446832.1.95308 WP_000446832.1.96934 WP_000446832.1.97781 WP_000446832.1.97861 WP_000446832.1.98216 WP_000446832.1.99445 WP_000446832.1.99485 WP_000446832.1.99994 YP_027308.1.16718 gi|47777902|ref|YP_017735.2| gi|49184056|ref|YP_027308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]