SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000487884.1.65758 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000487884.1.65758
Domain Number 1 Region: 387-472
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000487884.1.65758
Sequence length 483
Comment MULTISPECIES: sodium-independent anion transporter [Bacillus]; AA=GCF_001683695.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=B06.009; AL=Contig; RT=Major
Sequence
MFQTIKNDWFSNVKGDVLSGIVVALALIPEAIAFSVIAGVDPTVGLYAAFCIAVTISFVG
GRTGMISAATGAMALLMVTLVKDHGLQYLFATTILTGIVQIIFGVFKLSSFMKFVPKSVM
SGFLNSLGILVFTAQLPHFKNATWQMYALVALGLAIIYVFPRITTAVPSTLISIIIVTSI
ALMSGLQLKTVGDMGSLPKELPFFSMPDVPFTLETLGIILPYAVMLAIIGLLESLLTASV
LDDMTHTESNKHKEARGQGIANIVAGFFGGMAGCAMIGQSVINIKSGGRGRLSTFVAGGF
LIILLFVLGDYVVHIPMAALVAVMIMVSIGTFDWNSVTTIHKVPKGNAFVMIVTVVVVLI
THNLALGVIIGTVISAVLFAFNMAKIHVKHLYIENKKIYEIHGQLFFASTADLINNFSFE
EDVKEIELNFSHAHIWDDSAVASIDKVIMKYEQSGVKVSIMGLNERSAKLVTNLATYNKR
IAS
Download sequence
Identical sequences A0A150DUW1 A0A1J9XNN0 Q73DJ1
222523.BCE_0721 WP_000487884.1.24759 WP_000487884.1.39001 WP_000487884.1.45089 WP_000487884.1.49802 WP_000487884.1.65758 WP_000487884.1.79043 WP_000487884.1.92347 APC64543 GO.9087 gi|42779799|ref|NP_977046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]