SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000561176.1.41802 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000561176.1.41802
Domain Number 1 Region: 107-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000418
Family NfeD domain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  WP_000561176.1.41802
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00209
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000561176.1.41802
Sequence length 150
Comment membrane protein [Salmonella enterica]; AA=GCF_000462995.1; RF=na; TAX=1225522; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67; strain=CDC1983-67; AL=Complete Genome; RT=Major
Sequence
MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLTVWLLPLGWEWQGVLF
AALTLLAAWLWWRWLARRVREQKPTDSRLNQRGQQLVGRRFMLDAALVNGRGHMRVGDSS
WPVCADEDLRAGTHVEVIAVEDITLRIRAV
Download sequence
Identical sequences gi|378956110|ref|YP_005213597.1| gi|529220423|ref|YP_008381678.1| WP_000561176.1.29711 WP_000561176.1.41802 WP_000561176.1.42595 WP_000561176.1.44187 WP_000561176.1.48524 WP_000561176.1.51518 WP_000561176.1.54068 WP_000561176.1.79910 WP_000561176.1.90983 gi|537437676|ref|YP_008482053.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]