SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000561177.1.49311 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000561177.1.49311
Domain Number 1 Region: 107-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000379
Family NfeD domain-like 0.0063
Further Details:      
 
Weak hits

Sequence:  WP_000561177.1.49311
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0017
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000561177.1.49311
Sequence length 150
Comment membrane protein [Salmonella enterica]; AA=GCF_001973145.1; RF=na; TAX=149539; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Enteritidis; strain=CFSAN051886; AL=Contig; RT=Major
Sequence
MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLTVWLLPLGWEWQGVLF
AALTLLAAWLWWRWLARRVREQKPTDSRLNQRGQQLVGRRFMLDAALVNGRGHMRVGDSS
WPVCADEDLRAGTHVEVIAVEGITLRIRAV
Download sequence
Identical sequences A0A0F5B5J2 A0A0F6AXY3 A0A0F7J6L3 A0A0G2NJZ3 A0A0H3BMX8 A0A0H3NDS6 A0A0J0X539 A0A0L3JGT1 A0A0M0Q842 A0A0N1QYT7 A0A0R9NS87 A0A0T9VX93 A0A0T9X866 A0A0V2F210 A0A1C2ZZE8 A0A1R3BUT5 A0A1S0ZH00 A0A1S1AN89 A0A1X2RUL2 A0A1X2TDA9 A0A1X2URP8 A0A1X2Y8F2 A0A1Z3Q1D2 A0A221Z323 A0A241SG54 A0A267SGF9 A0A271CEX0 A0A271CWD7 A0A2C6G2Y2 A0A2D1XUU4 A0A2D1Y8C2 A0A2D3TYR9 A0A2G1PA04 A0A2H9YMX7 A0A2I6MBF3 A0A2I6MNZ6 A0A2I6N2G5 A0A2I6NGB6 A0A2I6NU38 A0A2I6P763 A0A2K2YWX4 B5EXP3 B5R624 C0PVF2 E8X887 G4C6L0 Q57S64 Q7CR12 Q8XEN4 S4HQ01 V1XHP6 V7UVX9
gi|197247478|ref|YP_002145484.1| gi|378448842|ref|YP_005236201.1| gi|224582338|ref|YP_002636136.1| gi|378987902|ref|YP_005251066.1| gi|194442548|ref|YP_002039745.1| gi|549478549|ref|YP_008612351.1| gi|482904913|ref|YP_007903473.1| gi|16763880|ref|NP_459495.1| gi|550899950|ref|YP_008669042.1| GO.2569 gi|378960529|ref|YP_005218015.1| 209261.t2360 220341.STY0546 272994.SPAB_03066 321314.SC0541 423368.SNSL254_A0554 439843.SeSA_A0564 454166.SeAg_B0547 454169.SeHA_C0608 476213.SPC_0515 550537.SEN0481 550538.SG0511 99287.STM0500 gi|549723212|ref|YP_008643402.1| gi|205351807|ref|YP_002225608.1| gi|488654854|ref|YP_007926657.1| NP_455095.1.84458 NP_459495.1.58477 WP_000561177.1.100002 WP_000561177.1.100008 WP_000561177.1.100010 WP_000561177.1.100031 WP_000561177.1.100036 WP_000561177.1.100077 WP_000561177.1.100079 WP_000561177.1.100115 WP_000561177.1.100129 WP_000561177.1.10013 WP_000561177.1.100137 WP_000561177.1.100149 WP_000561177.1.100165 WP_000561177.1.100191 WP_000561177.1.100196 WP_000561177.1.1002 WP_000561177.1.100234 WP_000561177.1.100258 WP_000561177.1.100266 WP_000561177.1.100284 WP_000561177.1.100313 WP_000561177.1.100314 WP_000561177.1.100321 WP_000561177.1.100354 WP_000561177.1.100376 WP_000561177.1.100392 WP_000561177.1.100412 WP_000561177.1.100413 WP_000561177.1.100421 WP_000561177.1.100424 WP_000561177.1.100432 WP_000561177.1.100436 WP_000561177.1.100438 WP_000561177.1.100446 WP_000561177.1.100450 WP_000561177.1.100457 WP_000561177.1.100472 WP_000561177.1.100484 WP_000561177.1.100488 WP_000561177.1.100502 WP_000561177.1.100519 WP_000561177.1.100521 WP_000561177.1.100541 WP_000561177.1.100557 WP_000561177.1.100589 WP_000561177.1.100592 WP_000561177.1.100597 WP_000561177.1.100605 WP_000561177.1.100610 WP_000561177.1.100642 WP_000561177.1.10065 WP_000561177.1.100707 WP_000561177.1.100711 WP_000561177.1.100714 WP_000561177.1.100721 WP_000561177.1.100730 WP_000561177.1.100732 WP_000561177.1.100733 WP_000561177.1.100739 WP_000561177.1.10076 WP_000561177.1.100764 WP_000561177.1.100776 WP_000561177.1.100781 WP_000561177.1.100790 WP_000561177.1.100793 WP_000561177.1.100799 WP_000561177.1.10081 WP_000561177.1.100814 WP_000561177.1.100857 WP_000561177.1.100865 WP_000561177.1.100869 WP_000561177.1.100870 WP_000561177.1.100871 WP_000561177.1.100882 WP_000561177.1.100895 WP_000561177.1.100932 WP_000561177.1.100941 WP_000561177.1.100953 WP_000561177.1.101007 WP_000561177.1.101011 WP_000561177.1.101020 WP_000561177.1.101042 WP_000561177.1.101074 WP_000561177.1.101078 WP_000561177.1.10108 WP_000561177.1.101091 WP_000561177.1.101094 WP_000561177.1.101112 WP_000561177.1.101123 WP_000561177.1.101126 WP_000561177.1.101147 WP_000561177.1.101180 WP_000561177.1.101185 WP_000561177.1.101199 WP_000561177.1.101223 WP_000561177.1.101226 WP_000561177.1.10124 WP_000561177.1.101259 WP_000561177.1.101271 WP_000561177.1.101284 WP_000561177.1.101291 WP_000561177.1.1013 WP_000561177.1.101312 WP_000561177.1.101320 WP_000561177.1.101322 WP_000561177.1.101353 WP_000561177.1.101374 WP_000561177.1.101386 WP_000561177.1.101404 WP_000561177.1.101420 WP_000561177.1.101425 WP_000561177.1.101454 WP_000561177.1.101473 WP_000561177.1.101520 WP_000561177.1.101541 WP_000561177.1.101589 WP_000561177.1.101609 WP_000561177.1.101612 WP_000561177.1.101616 WP_000561177.1.101634 WP_000561177.1.101636 WP_000561177.1.101639 WP_000561177.1.10164 WP_000561177.1.101666 WP_000561177.1.101674 WP_000561177.1.101707 WP_000561177.1.101724 WP_000561177.1.101734 WP_000561177.1.101740 WP_000561177.1.101741 WP_000561177.1.101744 WP_000561177.1.101759 WP_000561177.1.10177 WP_000561177.1.101776 WP_000561177.1.101815 WP_000561177.1.101832 WP_000561177.1.101841 WP_000561177.1.101868 WP_000561177.1.101878 WP_000561177.1.101890 WP_000561177.1.10191 WP_000561177.1.101917 WP_000561177.1.101941 WP_000561177.1.101953 WP_000561177.1.101975 WP_000561177.1.102009 WP_000561177.1.102050 WP_000561177.1.102087 WP_000561177.1.102103 WP_000561177.1.102111 WP_000561177.1.10220 WP_000561177.1.10231 WP_000561177.1.10237 WP_000561177.1.10266 WP_000561177.1.10276 WP_000561177.1.10293 WP_000561177.1.10300 WP_000561177.1.10310 WP_000561177.1.10338 WP_000561177.1.1038 WP_000561177.1.10394 WP_000561177.1.104 WP_000561177.1.10401 WP_000561177.1.10428 WP_000561177.1.10429 WP_000561177.1.10439 WP_000561177.1.10459 WP_000561177.1.10463 WP_000561177.1.10465 WP_000561177.1.10475 WP_000561177.1.10498 WP_000561177.1.10507 WP_000561177.1.10511 WP_000561177.1.10514 WP_000561177.1.10521 WP_000561177.1.10530 WP_000561177.1.10532 WP_000561177.1.10547 WP_000561177.1.10562 WP_000561177.1.10566 WP_000561177.1.10568 WP_000561177.1.10595 WP_000561177.1.106 WP_000561177.1.10631 WP_000561177.1.10642 WP_000561177.1.10654 WP_000561177.1.10675 WP_000561177.1.10677 WP_000561177.1.10678 WP_000561177.1.10711 WP_000561177.1.10720 WP_000561177.1.10753 WP_000561177.1.10755 WP_000561177.1.10797 WP_000561177.1.10857 WP_000561177.1.10868 WP_000561177.1.10873 WP_000561177.1.10898 WP_000561177.1.10926 WP_000561177.1.10936 WP_000561177.1.10992 WP_000561177.1.11000 WP_000561177.1.11012 WP_000561177.1.11024 WP_000561177.1.11031 WP_000561177.1.11041 WP_000561177.1.11055 WP_000561177.1.11098 WP_000561177.1.1110 WP_000561177.1.11119 WP_000561177.1.11126 WP_000561177.1.11142 WP_000561177.1.11156 WP_000561177.1.11168 WP_000561177.1.11190 WP_000561177.1.11213 WP_000561177.1.11216 WP_000561177.1.11239 WP_000561177.1.11253 WP_000561177.1.11254 WP_000561177.1.11295 WP_000561177.1.113 WP_000561177.1.11314 WP_000561177.1.1135 WP_000561177.1.11362 WP_000561177.1.11369 WP_000561177.1.1137 WP_000561177.1.11385 WP_000561177.1.11405 WP_000561177.1.1142 WP_000561177.1.11426 WP_000561177.1.11429 WP_000561177.1.11444 WP_000561177.1.11455 WP_000561177.1.11458 WP_000561177.1.11479 WP_000561177.1.1150 WP_000561177.1.11511 WP_000561177.1.11518 WP_000561177.1.11526 WP_000561177.1.11528 WP_000561177.1.11532 WP_000561177.1.11543 WP_000561177.1.11544 WP_000561177.1.11557 WP_000561177.1.1156 WP_000561177.1.11565 WP_000561177.1.11567 WP_000561177.1.11588 WP_000561177.1.11603 WP_000561177.1.11621 WP_000561177.1.11638 WP_000561177.1.11677 WP_000561177.1.11681 WP_000561177.1.11687 WP_000561177.1.1169 WP_000561177.1.11735 WP_000561177.1.1174 WP_000561177.1.11763 WP_000561177.1.11772 WP_000561177.1.11824 WP_000561177.1.11834 WP_000561177.1.11841 WP_000561177.1.11875 WP_000561177.1.11883 WP_000561177.1.11897 WP_000561177.1.11900 WP_000561177.1.11908 WP_000561177.1.11914 WP_000561177.1.11936 WP_000561177.1.11964 WP_000561177.1.11978 WP_000561177.1.12007 WP_000561177.1.12017 WP_000561177.1.12025 WP_000561177.1.12027 WP_000561177.1.12040 WP_000561177.1.12059 WP_000561177.1.12061 WP_000561177.1.12063 WP_000561177.1.1207 WP_000561177.1.12106 WP_000561177.1.12114 WP_000561177.1.12141 WP_000561177.1.12144 WP_000561177.1.1215 WP_000561177.1.12160 WP_000561177.1.12168 WP_000561177.1.12172 WP_000561177.1.12192 WP_000561177.1.1224 WP_000561177.1.12244 WP_000561177.1.12280 WP_000561177.1.12282 WP_000561177.1.12340 WP_000561177.1.12351 WP_000561177.1.12364 WP_000561177.1.12370 WP_000561177.1.12374 WP_000561177.1.12396 WP_000561177.1.12397 WP_000561177.1.12398 WP_000561177.1.12441 WP_000561177.1.1246 WP_000561177.1.12484 WP_000561177.1.12485 WP_000561177.1.1250 WP_000561177.1.12517 WP_000561177.1.12546 WP_000561177.1.12568 WP_000561177.1.12569 WP_000561177.1.12581 WP_000561177.1.12584 WP_000561177.1.12585 WP_000561177.1.12620 WP_000561177.1.1264 WP_000561177.1.12648 WP_000561177.1.12650 WP_000561177.1.12683 WP_000561177.1.12696 WP_000561177.1.12701 WP_000561177.1.12718 WP_000561177.1.12726 WP_000561177.1.12727 WP_000561177.1.12728 WP_000561177.1.12741 WP_000561177.1.12834 WP_000561177.1.12864 WP_000561177.1.12877 WP_000561177.1.12879 WP_000561177.1.12936 WP_000561177.1.1299 WP_000561177.1.12995 WP_000561177.1.1300 WP_000561177.1.13027 WP_000561177.1.13076 WP_000561177.1.13102 WP_000561177.1.13106 WP_000561177.1.13108 WP_000561177.1.13130 WP_000561177.1.13161 WP_000561177.1.13207 WP_000561177.1.1321 WP_000561177.1.13247 WP_000561177.1.1326 WP_000561177.1.13268 WP_000561177.1.13274 WP_000561177.1.13291 WP_000561177.1.133 WP_000561177.1.13314 WP_000561177.1.13334 WP_000561177.1.13338 WP_000561177.1.13342 WP_000561177.1.13352 WP_000561177.1.13367 WP_000561177.1.13391 WP_000561177.1.13406 WP_000561177.1.13414 WP_000561177.1.13429 WP_000561177.1.13440 WP_000561177.1.13443 WP_000561177.1.13446 WP_000561177.1.1346 WP_000561177.1.13476 WP_000561177.1.13488 WP_000561177.1.13509 WP_000561177.1.13528 WP_000561177.1.13543 WP_000561177.1.13573 WP_000561177.1.13599 WP_000561177.1.13625 WP_000561177.1.13661 WP_000561177.1.13669 WP_000561177.1.13677 WP_000561177.1.13686 WP_000561177.1.13691 WP_000561177.1.1372 WP_000561177.1.13732 WP_000561177.1.13741 WP_000561177.1.13750 WP_000561177.1.13799 WP_000561177.1.13812 WP_000561177.1.13819 WP_000561177.1.1382 WP_000561177.1.13827 WP_000561177.1.13829 WP_000561177.1.13848 WP_000561177.1.1387 WP_000561177.1.13908 WP_000561177.1.13932 WP_000561177.1.13968 WP_000561177.1.1397 WP_000561177.1.13972 WP_000561177.1.140 WP_000561177.1.14001 WP_000561177.1.1401 WP_000561177.1.14011 WP_000561177.1.14041 WP_000561177.1.14050 WP_000561177.1.14056 WP_000561177.1.1408 WP_000561177.1.14089 WP_000561177.1.14099 WP_000561177.1.14111 WP_000561177.1.1412 WP_000561177.1.14120 WP_000561177.1.14123 WP_000561177.1.14150 WP_000561177.1.14151 WP_000561177.1.14191 WP_000561177.1.14197 WP_000561177.1.14212 WP_000561177.1.14239 WP_000561177.1.14280 WP_000561177.1.14286 WP_000561177.1.14296 WP_000561177.1.14320 WP_000561177.1.14333 WP_000561177.1.14379 WP_000561177.1.14399 WP_000561177.1.14406 WP_000561177.1.14410 WP_000561177.1.14436 WP_000561177.1.14444 WP_000561177.1.14446 WP_000561177.1.14458 WP_000561177.1.14467 WP_000561177.1.14474 WP_000561177.1.14500 WP_000561177.1.14505 WP_000561177.1.14516 WP_000561177.1.14519 WP_000561177.1.14524 WP_000561177.1.14526 WP_000561177.1.14528 WP_000561177.1.14550 WP_000561177.1.14554 WP_000561177.1.14575 WP_000561177.1.146 WP_000561177.1.14618 WP_000561177.1.14688 WP_000561177.1.14701 WP_000561177.1.14703 WP_000561177.1.14706 WP_000561177.1.14708 WP_000561177.1.14719 WP_000561177.1.14725 WP_000561177.1.1473 WP_000561177.1.14765 WP_000561177.1.14789 WP_000561177.1.14793 WP_000561177.1.14808 WP_000561177.1.14810 WP_000561177.1.14819 WP_000561177.1.14852 WP_000561177.1.14876 WP_000561177.1.14877 WP_000561177.1.14884 WP_000561177.1.1489 WP_000561177.1.14894 WP_000561177.1.14913 WP_000561177.1.14917 WP_000561177.1.14927 WP_000561177.1.14930 WP_000561177.1.14932 WP_000561177.1.14936 WP_000561177.1.14947 WP_000561177.1.14948 WP_000561177.1.15046 WP_000561177.1.15054 WP_000561177.1.15055 WP_000561177.1.15059 WP_000561177.1.15067 WP_000561177.1.15079 WP_000561177.1.15100 WP_000561177.1.15102 WP_000561177.1.15184 WP_000561177.1.15223 WP_000561177.1.15226 WP_000561177.1.15244 WP_000561177.1.15265 WP_000561177.1.15276 WP_000561177.1.15316 WP_000561177.1.15318 WP_000561177.1.15353 WP_000561177.1.15362 WP_000561177.1.15369 WP_000561177.1.1540 WP_000561177.1.15415 WP_000561177.1.15423 WP_000561177.1.15433 WP_000561177.1.15439 WP_000561177.1.15468 WP_000561177.1.15479 WP_000561177.1.15483 WP_000561177.1.15486 WP_000561177.1.15487 WP_000561177.1.15508 WP_000561177.1.15535 WP_000561177.1.15581 WP_000561177.1.15585 WP_000561177.1.15586 WP_000561177.1.15597 WP_000561177.1.15616 WP_000561177.1.15625 WP_000561177.1.15627 WP_000561177.1.15637 WP_000561177.1.15644 WP_000561177.1.1568 WP_000561177.1.15708 WP_000561177.1.15710 WP_000561177.1.15717 WP_000561177.1.15775 WP_000561177.1.15777 WP_000561177.1.15784 WP_000561177.1.15795 WP_000561177.1.158 WP_000561177.1.15830 WP_000561177.1.15835 WP_000561177.1.15862 WP_000561177.1.15881 WP_000561177.1.15905 WP_000561177.1.15909 WP_000561177.1.15910 WP_000561177.1.15912 WP_000561177.1.1592 WP_000561177.1.15922 WP_000561177.1.15970 WP_000561177.1.15978 WP_000561177.1.15986 WP_000561177.1.15995 WP_000561177.1.16004 WP_000561177.1.16006 WP_000561177.1.1601 WP_000561177.1.16028 WP_000561177.1.16032 WP_000561177.1.16046 WP_000561177.1.16047 WP_000561177.1.16051 WP_000561177.1.16052 WP_000561177.1.16058 WP_000561177.1.16062 WP_000561177.1.16063 WP_000561177.1.16103 WP_000561177.1.1611 WP_000561177.1.16150 WP_000561177.1.16155 WP_000561177.1.16158 WP_000561177.1.16166 WP_000561177.1.16172 WP_000561177.1.16201 WP_000561177.1.16226 WP_000561177.1.16233 WP_000561177.1.16244 WP_000561177.1.1626 WP_000561177.1.16264 WP_000561177.1.16273 WP_000561177.1.16284 WP_000561177.1.16328 WP_000561177.1.16331 WP_000561177.1.16344 WP_000561177.1.1635 WP_000561177.1.16361 WP_000561177.1.16363 WP_000561177.1.16365 WP_000561177.1.16366 WP_000561177.1.16394 WP_000561177.1.16452 WP_000561177.1.16453 WP_000561177.1.16461 WP_000561177.1.16462 WP_000561177.1.16465 WP_000561177.1.16468 WP_000561177.1.16474 WP_000561177.1.16508 WP_000561177.1.16522 WP_000561177.1.16525 WP_000561177.1.16551 WP_000561177.1.16581 WP_000561177.1.16588 WP_000561177.1.16614 WP_000561177.1.16650 WP_000561177.1.16656 WP_000561177.1.16658 WP_000561177.1.16666 WP_000561177.1.16673 WP_000561177.1.1668 WP_000561177.1.16686 WP_000561177.1.16691 WP_000561177.1.167 WP_000561177.1.16729 WP_000561177.1.16732 WP_000561177.1.16735 WP_000561177.1.16736 WP_000561177.1.1674 WP_000561177.1.16767 WP_000561177.1.16781 WP_000561177.1.16786 WP_000561177.1.16804 WP_000561177.1.16817 WP_000561177.1.16819 WP_000561177.1.16826 WP_000561177.1.16855 WP_000561177.1.16858 WP_000561177.1.16873 WP_000561177.1.16879 WP_000561177.1.1689 WP_000561177.1.16893 WP_000561177.1.16896 WP_000561177.1.16903 WP_000561177.1.16905 WP_000561177.1.16910 WP_000561177.1.16916 WP_000561177.1.16941 WP_000561177.1.16942 WP_000561177.1.16948 WP_000561177.1.16949 WP_000561177.1.16965 WP_000561177.1.16972 WP_000561177.1.16998 WP_000561177.1.1700 WP_000561177.1.17031 WP_000561177.1.17049 WP_000561177.1.17058 WP_000561177.1.17060 WP_000561177.1.17078 WP_000561177.1.17093 WP_000561177.1.17096 WP_000561177.1.17098 WP_000561177.1.17105 WP_000561177.1.17188 WP_000561177.1.17202 WP_000561177.1.17219 WP_000561177.1.1722 WP_000561177.1.17270 WP_000561177.1.17285 WP_000561177.1.17302 WP_000561177.1.17307 WP_000561177.1.17308 WP_000561177.1.1733 WP_000561177.1.17368 WP_000561177.1.1737 WP_000561177.1.17390 WP_000561177.1.174 WP_000561177.1.17405 WP_000561177.1.17406 WP_000561177.1.17439 WP_000561177.1.17447 WP_000561177.1.17480 WP_000561177.1.17482 WP_000561177.1.17504 WP_000561177.1.17513 WP_000561177.1.17525 WP_000561177.1.17543 WP_000561177.1.17546 WP_000561177.1.17560 WP_000561177.1.17563 WP_000561177.1.1757 WP_000561177.1.17578 WP_000561177.1.17583 WP_000561177.1.17622 WP_000561177.1.17629 WP_000561177.1.17659 WP_000561177.1.17667 WP_000561177.1.17686 WP_000561177.1.17693 WP_000561177.1.17702 WP_000561177.1.17703 WP_000561177.1.17705 WP_000561177.1.17732 WP_000561177.1.17741 WP_000561177.1.17743 WP_000561177.1.17747 WP_000561177.1.17755 WP_000561177.1.17758 WP_000561177.1.17840 WP_000561177.1.17865 WP_000561177.1.17886 WP_000561177.1.17891 WP_000561177.1.17901 WP_000561177.1.17914 WP_000561177.1.17919 WP_000561177.1.17936 WP_000561177.1.17949 WP_000561177.1.17956 WP_000561177.1.1798 WP_000561177.1.17991 WP_000561177.1.18005 WP_000561177.1.1801 WP_000561177.1.18019 WP_000561177.1.18021 WP_000561177.1.18056 WP_000561177.1.18061 WP_000561177.1.1807 WP_000561177.1.18089 WP_000561177.1.18092 WP_000561177.1.18099 WP_000561177.1.18103 WP_000561177.1.18109 WP_000561177.1.18111 WP_000561177.1.18122 WP_000561177.1.18124 WP_000561177.1.1814 WP_000561177.1.18144 WP_000561177.1.18149 WP_000561177.1.18163 WP_000561177.1.18173 WP_000561177.1.18177 WP_000561177.1.18178 WP_000561177.1.1818 WP_000561177.1.18192 WP_000561177.1.1825 WP_000561177.1.18254 WP_000561177.1.18265 WP_000561177.1.18267 WP_000561177.1.18270 WP_000561177.1.18277 WP_000561177.1.18280 WP_000561177.1.18281 WP_000561177.1.18282 WP_000561177.1.18328 WP_000561177.1.18358 WP_000561177.1.18365 WP_000561177.1.18370 WP_000561177.1.18384 WP_000561177.1.18406 WP_000561177.1.18441 WP_000561177.1.18445 WP_000561177.1.18468 WP_000561177.1.18474 WP_000561177.1.18483 WP_000561177.1.18485 WP_000561177.1.18489 WP_000561177.1.18513 WP_000561177.1.18607 WP_000561177.1.18610 WP_000561177.1.18641 WP_000561177.1.18678 WP_000561177.1.18686 WP_000561177.1.18688 WP_000561177.1.18692 WP_000561177.1.18705 WP_000561177.1.18715 WP_000561177.1.18722 WP_000561177.1.18737 WP_000561177.1.18766 WP_000561177.1.18776 WP_000561177.1.1880 WP_000561177.1.18822 WP_000561177.1.18847 WP_000561177.1.1885 WP_000561177.1.18860 WP_000561177.1.18881 WP_000561177.1.18886 WP_000561177.1.18895 WP_000561177.1.18919 WP_000561177.1.18922 WP_000561177.1.18940 WP_000561177.1.18949 WP_000561177.1.1895 WP_000561177.1.18959 WP_000561177.1.1897 WP_000561177.1.18972 WP_000561177.1.19001 WP_000561177.1.19006 WP_000561177.1.19030 WP_000561177.1.19038 WP_000561177.1.19044 WP_000561177.1.19053 WP_000561177.1.19055 WP_000561177.1.19064 WP_000561177.1.19084 WP_000561177.1.19093 WP_000561177.1.19163 WP_000561177.1.19174 WP_000561177.1.19187 WP_000561177.1.19228 WP_000561177.1.19240 WP_000561177.1.19273 WP_000561177.1.19288 WP_000561177.1.19300 WP_000561177.1.19320 WP_000561177.1.19340 WP_000561177.1.19357 WP_000561177.1.19373 WP_000561177.1.1939 WP_000561177.1.19405 WP_000561177.1.19422 WP_000561177.1.19433 WP_000561177.1.19454 WP_000561177.1.19456 WP_000561177.1.19458 WP_000561177.1.19460 WP_000561177.1.19461 WP_000561177.1.19469 WP_000561177.1.19496 WP_000561177.1.19535 WP_000561177.1.19538 WP_000561177.1.1954 WP_000561177.1.1955 WP_000561177.1.19588 WP_000561177.1.19589 WP_000561177.1.19614 WP_000561177.1.19616 WP_000561177.1.19642 WP_000561177.1.19656 WP_000561177.1.19660 WP_000561177.1.19663 WP_000561177.1.1968 WP_000561177.1.19683 WP_000561177.1.19686 WP_000561177.1.19702 WP_000561177.1.19706 WP_000561177.1.19723 WP_000561177.1.19724 WP_000561177.1.19731 WP_000561177.1.19740 WP_000561177.1.19749 WP_000561177.1.19784 WP_000561177.1.19793 WP_000561177.1.19794 WP_000561177.1.19802 WP_000561177.1.19809 WP_000561177.1.19823 WP_000561177.1.19834 WP_000561177.1.19851 WP_000561177.1.19863 WP_000561177.1.19867 WP_000561177.1.19884 WP_000561177.1.1990 WP_000561177.1.1992 WP_000561177.1.19938 WP_000561177.1.19967 WP_000561177.1.19970 WP_000561177.1.19975 WP_000561177.1.1998 WP_000561177.1.19987 WP_000561177.1.19999 WP_000561177.1.20034 WP_000561177.1.20081 WP_000561177.1.20086 WP_000561177.1.20089 WP_000561177.1.20091 WP_000561177.1.2010 WP_000561177.1.20119 WP_000561177.1.20212 WP_000561177.1.20218 WP_000561177.1.20254 WP_000561177.1.20255 WP_000561177.1.2026 WP_000561177.1.20261 WP_000561177.1.20266 WP_000561177.1.20271 WP_000561177.1.20296 WP_000561177.1.20330 WP_000561177.1.20339 WP_000561177.1.20349 WP_000561177.1.2036 WP_000561177.1.20362 WP_000561177.1.20364 WP_000561177.1.20391 WP_000561177.1.2041 WP_000561177.1.20415 WP_000561177.1.20418 WP_000561177.1.20419 WP_000561177.1.20425 WP_000561177.1.20437 WP_000561177.1.20443 WP_000561177.1.20446 WP_000561177.1.20465 WP_000561177.1.2047 WP_000561177.1.20488 WP_000561177.1.20492 WP_000561177.1.20503 WP_000561177.1.20525 WP_000561177.1.2053 WP_000561177.1.2054 WP_000561177.1.20553 WP_000561177.1.20573 WP_000561177.1.20614 WP_000561177.1.20626 WP_000561177.1.20631 WP_000561177.1.20635 WP_000561177.1.20646 WP_000561177.1.20695 WP_000561177.1.20700 WP_000561177.1.20718 WP_000561177.1.20721 WP_000561177.1.2073 WP_000561177.1.20740 WP_000561177.1.20760 WP_000561177.1.20787 WP_000561177.1.20795 WP_000561177.1.20810 WP_000561177.1.20828 WP_000561177.1.20839 WP_000561177.1.20862 WP_000561177.1.2087 WP_000561177.1.20883 WP_000561177.1.20886 WP_000561177.1.20900 WP_000561177.1.20908 WP_000561177.1.20947 WP_000561177.1.20953 WP_000561177.1.2101 WP_000561177.1.21010 WP_000561177.1.21049 WP_000561177.1.2106 WP_000561177.1.21062 WP_000561177.1.2107 WP_000561177.1.21075 WP_000561177.1.21079 WP_000561177.1.21086 WP_000561177.1.21089 WP_000561177.1.21103 WP_000561177.1.21136 WP_000561177.1.21144 WP_000561177.1.21146 WP_000561177.1.2116 WP_000561177.1.21162 WP_000561177.1.21165 WP_000561177.1.21181 WP_000561177.1.21184 WP_000561177.1.21185 WP_000561177.1.21194 WP_000561177.1.21202 WP_000561177.1.21241 WP_000561177.1.21245 WP_000561177.1.21246 WP_000561177.1.21260 WP_000561177.1.21269 WP_000561177.1.2130 WP_000561177.1.21309 WP_000561177.1.21326 WP_000561177.1.21332 WP_000561177.1.21351 WP_000561177.1.21362 WP_000561177.1.21366 WP_000561177.1.21400 WP_000561177.1.21404 WP_000561177.1.21423 WP_000561177.1.21453 WP_000561177.1.2146 WP_000561177.1.21473 WP_000561177.1.21492 WP_000561177.1.21497 WP_000561177.1.21499 WP_000561177.1.21548 WP_000561177.1.21603 WP_000561177.1.2166 WP_000561177.1.21674 WP_000561177.1.21681 WP_000561177.1.21692 WP_000561177.1.21715 WP_000561177.1.21728 WP_000561177.1.21730 WP_000561177.1.21750 WP_000561177.1.21751 WP_000561177.1.21757 WP_000561177.1.21792 WP_000561177.1.21825 WP_000561177.1.21845 WP_000561177.1.21877 WP_000561177.1.21886 WP_000561177.1.21909 WP_000561177.1.21940 WP_000561177.1.21946 WP_000561177.1.21950 WP_000561177.1.21966 WP_000561177.1.21981 WP_000561177.1.21991 WP_000561177.1.22019 WP_000561177.1.22024 WP_000561177.1.22030 WP_000561177.1.2205 WP_000561177.1.22051 WP_000561177.1.22062 WP_000561177.1.22064 WP_000561177.1.22067 WP_000561177.1.22069 WP_000561177.1.22096 WP_000561177.1.22117 WP_000561177.1.22118 WP_000561177.1.22126 WP_000561177.1.22136 WP_000561177.1.22158 WP_000561177.1.2216 WP_000561177.1.22162 WP_000561177.1.22169 WP_000561177.1.22208 WP_000561177.1.2221 WP_000561177.1.22235 WP_000561177.1.2224 WP_000561177.1.22240 WP_000561177.1.2227 WP_000561177.1.22270 WP_000561177.1.22296 WP_000561177.1.22303 WP_000561177.1.22315 WP_000561177.1.22323 WP_000561177.1.22337 WP_000561177.1.22346 WP_000561177.1.2235 WP_000561177.1.22373 WP_000561177.1.22379 WP_000561177.1.22388 WP_000561177.1.22427 WP_000561177.1.22449 WP_000561177.1.22453 WP_000561177.1.22454 WP_000561177.1.2246 WP_000561177.1.22460 WP_000561177.1.22476 WP_000561177.1.22485 WP_000561177.1.22514 WP_000561177.1.22537 WP_000561177.1.22575 WP_000561177.1.22595 WP_000561177.1.22604 WP_000561177.1.22605 WP_000561177.1.22614 WP_000561177.1.22620 WP_000561177.1.22623 WP_000561177.1.22652 WP_000561177.1.22676 WP_000561177.1.22683 WP_000561177.1.22692 WP_000561177.1.22758 WP_000561177.1.22760 WP_000561177.1.2283 WP_000561177.1.2284 WP_000561177.1.22845 WP_000561177.1.22855 WP_000561177.1.22857 WP_000561177.1.22864 WP_000561177.1.22870 WP_000561177.1.22880 WP_000561177.1.22895 WP_000561177.1.22902 WP_000561177.1.22926 WP_000561177.1.22943 WP_000561177.1.22947 WP_000561177.1.22966 WP_000561177.1.22967 WP_000561177.1.22979 WP_000561177.1.23010 WP_000561177.1.23040 WP_000561177.1.23041 WP_000561177.1.23053 WP_000561177.1.23058 WP_000561177.1.23080 WP_000561177.1.23102 WP_000561177.1.23114 WP_000561177.1.2314 WP_000561177.1.23148 WP_000561177.1.23155 WP_000561177.1.23169 WP_000561177.1.23192 WP_000561177.1.23201 WP_000561177.1.23218 WP_000561177.1.2324 WP_000561177.1.23246 WP_000561177.1.23258 WP_000561177.1.23259 WP_000561177.1.23274 WP_000561177.1.23279 WP_000561177.1.2331 WP_000561177.1.2332 WP_000561177.1.23329 WP_000561177.1.23340 WP_000561177.1.2336 WP_000561177.1.23365 WP_000561177.1.23379 WP_000561177.1.23409 WP_000561177.1.23412 WP_000561177.1.2342 WP_000561177.1.23426 WP_000561177.1.23442 WP_000561177.1.23444 WP_000561177.1.23460 WP_000561177.1.23466 WP_000561177.1.23472 WP_000561177.1.23485 WP_000561177.1.23492 WP_000561177.1.235 WP_000561177.1.23503 WP_000561177.1.23509 WP_000561177.1.23513 WP_000561177.1.23515 WP_000561177.1.23529 WP_000561177.1.23548 WP_000561177.1.23571 WP_000561177.1.2358 WP_000561177.1.23587 WP_000561177.1.23604 WP_000561177.1.23621 WP_000561177.1.23629 WP_000561177.1.23631 WP_000561177.1.23634 WP_000561177.1.23639 WP_000561177.1.2364 WP_000561177.1.23643 WP_000561177.1.23646 WP_000561177.1.23675 WP_000561177.1.23679 WP_000561177.1.23685 WP_000561177.1.23707 WP_000561177.1.23728 WP_000561177.1.23736 WP_000561177.1.23746 WP_000561177.1.2375 WP_000561177.1.2376 WP_000561177.1.23783 WP_000561177.1.23786 WP_000561177.1.23787 WP_000561177.1.23801 WP_000561177.1.23819 WP_000561177.1.23932 WP_000561177.1.23959 WP_000561177.1.24017 WP_000561177.1.24028 WP_000561177.1.24061 WP_000561177.1.24082 WP_000561177.1.24083 WP_000561177.1.24117 WP_000561177.1.24125 WP_000561177.1.24138 WP_000561177.1.24145 WP_000561177.1.2415 WP_000561177.1.24153 WP_000561177.1.24158 WP_000561177.1.24206 WP_000561177.1.24214 WP_000561177.1.24250 WP_000561177.1.24259 WP_000561177.1.24291 WP_000561177.1.24297 WP_000561177.1.24303 WP_000561177.1.24308 WP_000561177.1.24322 WP_000561177.1.24325 WP_000561177.1.24355 WP_000561177.1.24361 WP_000561177.1.24375 WP_000561177.1.24376 WP_000561177.1.24392 WP_000561177.1.24400 WP_000561177.1.24409 WP_000561177.1.24412 WP_000561177.1.24419 WP_000561177.1.24420 WP_000561177.1.24450 WP_000561177.1.24476 WP_000561177.1.24494 WP_000561177.1.24521 WP_000561177.1.24555 WP_000561177.1.24567 WP_000561177.1.24578 WP_000561177.1.24619 WP_000561177.1.24643 WP_000561177.1.2467 WP_000561177.1.24673 WP_000561177.1.24688 WP_000561177.1.24689 WP_000561177.1.24696 WP_000561177.1.24716 WP_000561177.1.24723 WP_000561177.1.24727 WP_000561177.1.24737 WP_000561177.1.24779 WP_000561177.1.2481 WP_000561177.1.24832 WP_000561177.1.24837 WP_000561177.1.24873 WP_000561177.1.24901 WP_000561177.1.24944 WP_000561177.1.24964 WP_000561177.1.24995 WP_000561177.1.25008 WP_000561177.1.25015 WP_000561177.1.25017 WP_000561177.1.25032 WP_000561177.1.25036 WP_000561177.1.25041 WP_000561177.1.25053 WP_000561177.1.25119 WP_000561177.1.25130 WP_000561177.1.25140 WP_000561177.1.25159 WP_000561177.1.25175 WP_000561177.1.25185 WP_000561177.1.25196 WP_000561177.1.25205 WP_000561177.1.25206 WP_000561177.1.25210 WP_000561177.1.25217 WP_000561177.1.25219 WP_000561177.1.25229 WP_000561177.1.2525 WP_000561177.1.25297 WP_000561177.1.25304 WP_000561177.1.25354 WP_000561177.1.25374 WP_000561177.1.25397 WP_000561177.1.25405 WP_000561177.1.25426 WP_000561177.1.25454 WP_000561177.1.25475 WP_000561177.1.25490 WP_000561177.1.25493 WP_000561177.1.25508 WP_000561177.1.25512 WP_000561177.1.25514 WP_000561177.1.25546 WP_000561177.1.25564 WP_000561177.1.25596 WP_000561177.1.25603 WP_000561177.1.25607 WP_000561177.1.25618 WP_000561177.1.2562 WP_000561177.1.25666 WP_000561177.1.25668 WP_000561177.1.25690 WP_000561177.1.25692 WP_000561177.1.2570 WP_000561177.1.25700 WP_000561177.1.25708 WP_000561177.1.25740 WP_000561177.1.25780 WP_000561177.1.25807 WP_000561177.1.25809 WP_000561177.1.2581 WP_000561177.1.25814 WP_000561177.1.25821 WP_000561177.1.25825 WP_000561177.1.25833 WP_000561177.1.25835 WP_000561177.1.25882 WP_000561177.1.25911 WP_000561177.1.25928 WP_000561177.1.25932 WP_000561177.1.25944 WP_000561177.1.25951 WP_000561177.1.25962 WP_000561177.1.25963 WP_000561177.1.25988 WP_000561177.1.26001 WP_000561177.1.26027 WP_000561177.1.26030 WP_000561177.1.26034 WP_000561177.1.26075 WP_000561177.1.26083 WP_000561177.1.26093 WP_000561177.1.26107 WP_000561177.1.26123 WP_000561177.1.26129 WP_000561177.1.2615 WP_000561177.1.26194 WP_000561177.1.26199 WP_000561177.1.26213 WP_000561177.1.26217 WP_000561177.1.26224 WP_000561177.1.26230 WP_000561177.1.26232 WP_000561177.1.26269 WP_000561177.1.26272 WP_000561177.1.26282 WP_000561177.1.26286 WP_000561177.1.26288 WP_000561177.1.26311 WP_000561177.1.26319 WP_000561177.1.26363 WP_000561177.1.26384 WP_000561177.1.26394 WP_000561177.1.26426 WP_000561177.1.26429 WP_000561177.1.26440 WP_000561177.1.26441 WP_000561177.1.26491 WP_000561177.1.26493 WP_000561177.1.26512 WP_000561177.1.2654 WP_000561177.1.26551 WP_000561177.1.26554 WP_000561177.1.26563 WP_000561177.1.26567 WP_000561177.1.26582 WP_000561177.1.2660 WP_000561177.1.26636 WP_000561177.1.26646 WP_000561177.1.2667 WP_000561177.1.26687 WP_000561177.1.26689 WP_000561177.1.26709 WP_000561177.1.2672 WP_000561177.1.26741 WP_000561177.1.26758 WP_000561177.1.26787 WP_000561177.1.2679 WP_000561177.1.26794 WP_000561177.1.26833 WP_000561177.1.26856 WP_000561177.1.26882 WP_000561177.1.26883 WP_000561177.1.26908 WP_000561177.1.26919 WP_000561177.1.2692 WP_000561177.1.26924 WP_000561177.1.26928 WP_000561177.1.26936 WP_000561177.1.26980 WP_000561177.1.270 WP_000561177.1.27008 WP_000561177.1.27010 WP_000561177.1.27027 WP_000561177.1.27051 WP_000561177.1.27055 WP_000561177.1.27070 WP_000561177.1.27072 WP_000561177.1.27077 WP_000561177.1.27084 WP_000561177.1.27086 WP_000561177.1.27087 WP_000561177.1.27111 WP_000561177.1.27115 WP_000561177.1.27122 WP_000561177.1.2713 WP_000561177.1.27142 WP_000561177.1.27169 WP_000561177.1.2717 WP_000561177.1.27173 WP_000561177.1.272 WP_000561177.1.27206 WP_000561177.1.27223 WP_000561177.1.27228 WP_000561177.1.2723 WP_000561177.1.27255 WP_000561177.1.27272 WP_000561177.1.27279 WP_000561177.1.27282 WP_000561177.1.27285 WP_000561177.1.27309 WP_000561177.1.27314 WP_000561177.1.27329 WP_000561177.1.27342 WP_000561177.1.27361 WP_000561177.1.27383 WP_000561177.1.27419 WP_000561177.1.27423 WP_000561177.1.27452 WP_000561177.1.27513 WP_000561177.1.27522 WP_000561177.1.27523 WP_000561177.1.27544 WP_000561177.1.27547 WP_000561177.1.27556 WP_000561177.1.27561 WP_000561177.1.27565 WP_000561177.1.27595 WP_000561177.1.27598 WP_000561177.1.27616 WP_000561177.1.2763 WP_000561177.1.27632 WP_000561177.1.27638 WP_000561177.1.27655 WP_000561177.1.27658 WP_000561177.1.27665 WP_000561177.1.27679 WP_000561177.1.27706 WP_000561177.1.27707 WP_000561177.1.27755 WP_000561177.1.27761 WP_000561177.1.2777 WP_000561177.1.27775 WP_000561177.1.27776 WP_000561177.1.27785 WP_000561177.1.27798 WP_000561177.1.27800 WP_000561177.1.27833 WP_000561177.1.27857 WP_000561177.1.27883 WP_000561177.1.27900 WP_000561177.1.27928 WP_000561177.1.27945 WP_000561177.1.27969 WP_000561177.1.27977 WP_000561177.1.27995 WP_000561177.1.27997 WP_000561177.1.28002 WP_000561177.1.28004 WP_000561177.1.28032 WP_000561177.1.28037 WP_000561177.1.28056 WP_000561177.1.2806 WP_000561177.1.2809 WP_000561177.1.28094 WP_000561177.1.28116 WP_000561177.1.28126 WP_000561177.1.28139 WP_000561177.1.28155 WP_000561177.1.28170 WP_000561177.1.28174 WP_000561177.1.28198 WP_000561177.1.28200 WP_000561177.1.2822 WP_000561177.1.28229 WP_000561177.1.28232 WP_000561177.1.28233 WP_000561177.1.28235 WP_000561177.1.2825 WP_000561177.1.28267 WP_000561177.1.2829 WP_000561177.1.28301 WP_000561177.1.28302 WP_000561177.1.28303 WP_000561177.1.2835 WP_000561177.1.28370 WP_000561177.1.28384 WP_000561177.1.28386 WP_000561177.1.28393 WP_000561177.1.28395 WP_000561177.1.284 WP_000561177.1.2845 WP_000561177.1.28462 WP_000561177.1.28479 WP_000561177.1.28504 WP_000561177.1.28512 WP_000561177.1.28514 WP_000561177.1.2853 WP_000561177.1.28538 WP_000561177.1.28570 WP_000561177.1.28575 WP_000561177.1.28612 WP_000561177.1.28620 WP_000561177.1.28625 WP_000561177.1.28627 WP_000561177.1.28655 WP_000561177.1.28692 WP_000561177.1.28694 WP_000561177.1.287 WP_000561177.1.2873 WP_000561177.1.28733 WP_000561177.1.28773 WP_000561177.1.28775 WP_000561177.1.2879 WP_000561177.1.28811 WP_000561177.1.28830 WP_000561177.1.2890 WP_000561177.1.28902 WP_000561177.1.28917 WP_000561177.1.28921 WP_000561177.1.28938 WP_000561177.1.28946 WP_000561177.1.28948 WP_000561177.1.28962 WP_000561177.1.28963 WP_000561177.1.28977 WP_000561177.1.29006 WP_000561177.1.29010 WP_000561177.1.29023 WP_000561177.1.29042 WP_000561177.1.2905 WP_000561177.1.2907 WP_000561177.1.29081 WP_000561177.1.29089 WP_000561177.1.2910 WP_000561177.1.29113 WP_000561177.1.29130 WP_000561177.1.29153 WP_000561177.1.29168 WP_000561177.1.29174 WP_000561177.1.29190 WP_000561177.1.29203 WP_000561177.1.29218 WP_000561177.1.29237 WP_000561177.1.2924 WP_000561177.1.29248 WP_000561177.1.29265 WP_000561177.1.29288 WP_000561177.1.2932 WP_000561177.1.29349 WP_000561177.1.29379 WP_000561177.1.29389 WP_000561177.1.29422 WP_000561177.1.29436 WP_000561177.1.29439 WP_000561177.1.29454 WP_000561177.1.2946 WP_000561177.1.29462 WP_000561177.1.29509 WP_000561177.1.29530 WP_000561177.1.29563 WP_000561177.1.29576 WP_000561177.1.29588 WP_000561177.1.29593 WP_000561177.1.29601 WP_000561177.1.29606 WP_000561177.1.29615 WP_000561177.1.29619 WP_000561177.1.29682 WP_000561177.1.29704 WP_000561177.1.29727 WP_000561177.1.29732 WP_000561177.1.29743 WP_000561177.1.29768 WP_000561177.1.29774 WP_000561177.1.29782 WP_000561177.1.29827 WP_000561177.1.29833 WP_000561177.1.2984 WP_000561177.1.29845 WP_000561177.1.29851 WP_000561177.1.29865 WP_000561177.1.29886 WP_000561177.1.29898 WP_000561177.1.29919 WP_000561177.1.29923 WP_000561177.1.2994 WP_000561177.1.29964 WP_000561177.1.29969 WP_000561177.1.29983 WP_000561177.1.29990 WP_000561177.1.30006 WP_000561177.1.30009 WP_000561177.1.30013 WP_000561177.1.30018 WP_000561177.1.3002 WP_000561177.1.30022 WP_000561177.1.30027 WP_000561177.1.30034 WP_000561177.1.30049 WP_000561177.1.3005 WP_000561177.1.30058 WP_000561177.1.30059 WP_000561177.1.30086 WP_000561177.1.30093 WP_000561177.1.30165 WP_000561177.1.3017 WP_000561177.1.30172 WP_000561177.1.30179 WP_000561177.1.30180 WP_000561177.1.30185 WP_000561177.1.30202 WP_000561177.1.30210 WP_000561177.1.30213 WP_000561177.1.30225 WP_000561177.1.30238 WP_000561177.1.30246 WP_000561177.1.30278 WP_000561177.1.30331 WP_000561177.1.30354 WP_000561177.1.30356 WP_000561177.1.30357 WP_000561177.1.30362 WP_000561177.1.30386 WP_000561177.1.30389 WP_000561177.1.3042 WP_000561177.1.30421 WP_000561177.1.30440 WP_000561177.1.30448 WP_000561177.1.30469 WP_000561177.1.30489 WP_000561177.1.30492 WP_000561177.1.30505 WP_000561177.1.30507 WP_000561177.1.30517 WP_000561177.1.30535 WP_000561177.1.30542 WP_000561177.1.30544 WP_000561177.1.30547 WP_000561177.1.30548 WP_000561177.1.30556 WP_000561177.1.30572 WP_000561177.1.30573 WP_000561177.1.30585 WP_000561177.1.30589 WP_000561177.1.30602 WP_000561177.1.30618 WP_000561177.1.30619 WP_000561177.1.30627 WP_000561177.1.30635 WP_000561177.1.30664 WP_000561177.1.3068 WP_000561177.1.30688 WP_000561177.1.30696 WP_000561177.1.30752 WP_000561177.1.3076 WP_000561177.1.30794 WP_000561177.1.3080 WP_000561177.1.30802 WP_000561177.1.30803 WP_000561177.1.30806 WP_000561177.1.30819 WP_000561177.1.30833 WP_000561177.1.30835 WP_000561177.1.3089 WP_000561177.1.30909 WP_000561177.1.30934 WP_000561177.1.3095 WP_000561177.1.30967 WP_000561177.1.30968 WP_000561177.1.30972 WP_000561177.1.31 WP_000561177.1.31001 WP_000561177.1.31042 WP_000561177.1.31046 WP_000561177.1.31066 WP_000561177.1.31078 WP_000561177.1.31092 WP_000561177.1.31107 WP_000561177.1.31122 WP_000561177.1.3113 WP_000561177.1.31139 WP_000561177.1.3114 WP_000561177.1.31145 WP_000561177.1.31155 WP_000561177.1.31167 WP_000561177.1.31171 WP_000561177.1.31182 WP_000561177.1.31185 WP_000561177.1.3119 WP_000561177.1.31190 WP_000561177.1.31195 WP_000561177.1.31196 WP_000561177.1.31205 WP_000561177.1.3121 WP_000561177.1.31210 WP_000561177.1.31219 WP_000561177.1.31222 WP_000561177.1.31223 WP_000561177.1.3124 WP_000561177.1.31251 WP_000561177.1.31262 WP_000561177.1.3127 WP_000561177.1.31272 WP_000561177.1.31281 WP_000561177.1.31303 WP_000561177.1.3131 WP_000561177.1.31335 WP_000561177.1.31352 WP_000561177.1.31362 WP_000561177.1.31389 WP_000561177.1.31413 WP_000561177.1.31435 WP_000561177.1.31446 WP_000561177.1.31451 WP_000561177.1.31476 WP_000561177.1.31504 WP_000561177.1.31515 WP_000561177.1.31533 WP_000561177.1.31578 WP_000561177.1.31585 WP_000561177.1.31658 WP_000561177.1.31665 WP_000561177.1.3167 WP_000561177.1.3170 WP_000561177.1.31720 WP_000561177.1.31725 WP_000561177.1.31762 WP_000561177.1.31782 WP_000561177.1.31799 WP_000561177.1.31836 WP_000561177.1.31845 WP_000561177.1.3185 WP_000561177.1.31854 WP_000561177.1.31895 WP_000561177.1.31901 WP_000561177.1.31927 WP_000561177.1.31940 WP_000561177.1.31951 WP_000561177.1.31967 WP_000561177.1.31972 WP_000561177.1.32006 WP_000561177.1.32038 WP_000561177.1.32041 WP_000561177.1.32042 WP_000561177.1.32054 WP_000561177.1.3207 WP_000561177.1.32109 WP_000561177.1.32116 WP_000561177.1.32189 WP_000561177.1.32192 WP_000561177.1.32202 WP_000561177.1.32204 WP_000561177.1.32206 WP_000561177.1.32252 WP_000561177.1.32255 WP_000561177.1.32260 WP_000561177.1.32263 WP_000561177.1.32274 WP_000561177.1.32275 WP_000561177.1.32277 WP_000561177.1.32293 WP_000561177.1.32299 WP_000561177.1.32309 WP_000561177.1.32357 WP_000561177.1.32408 WP_000561177.1.32422 WP_000561177.1.32423 WP_000561177.1.32424 WP_000561177.1.32425 WP_000561177.1.32434 WP_000561177.1.32438 WP_000561177.1.32458 WP_000561177.1.32459 WP_000561177.1.32460 WP_000561177.1.32491 WP_000561177.1.32493 WP_000561177.1.32515 WP_000561177.1.32519 WP_000561177.1.32527 WP_000561177.1.32529 WP_000561177.1.32563 WP_000561177.1.32578 WP_000561177.1.32617 WP_000561177.1.32624 WP_000561177.1.32629 WP_000561177.1.32643 WP_000561177.1.32660 WP_000561177.1.32668 WP_000561177.1.3270 WP_000561177.1.32702 WP_000561177.1.32714 WP_000561177.1.32725 WP_000561177.1.32740 WP_000561177.1.32747 WP_000561177.1.32750 WP_000561177.1.3278 WP_000561177.1.32786 WP_000561177.1.32804 WP_000561177.1.32832 WP_000561177.1.32838 WP_000561177.1.32848 WP_000561177.1.32860 WP_000561177.1.32868 WP_000561177.1.32881 WP_000561177.1.32899 WP_000561177.1.3290 WP_000561177.1.32900 WP_000561177.1.32902 WP_000561177.1.32907 WP_000561177.1.32940 WP_000561177.1.32941 WP_000561177.1.3296 WP_000561177.1.32961 WP_000561177.1.32966 WP_000561177.1.32977 WP_000561177.1.32985 WP_000561177.1.33030 WP_000561177.1.33037 WP_000561177.1.3304 WP_000561177.1.3305 WP_000561177.1.33051 WP_000561177.1.33065 WP_000561177.1.33078 WP_000561177.1.3310 WP_000561177.1.33106 WP_000561177.1.33114 WP_000561177.1.33122 WP_000561177.1.33127 WP_000561177.1.33134 WP_000561177.1.33143 WP_000561177.1.3315 WP_000561177.1.33208 WP_000561177.1.33214 WP_000561177.1.33247 WP_000561177.1.33248 WP_000561177.1.33253 WP_000561177.1.33261 WP_000561177.1.33270 WP_000561177.1.33280 WP_000561177.1.33283 WP_000561177.1.333 WP_000561177.1.33313 WP_000561177.1.33339 WP_000561177.1.33343 WP_000561177.1.33382 WP_000561177.1.33392 WP_000561177.1.33409 WP_000561177.1.33486 WP_000561177.1.33490 WP_000561177.1.33492 WP_000561177.1.33499 WP_000561177.1.335 WP_000561177.1.33501 WP_000561177.1.33529 WP_000561177.1.33553 WP_000561177.1.3356 WP_000561177.1.33580 WP_000561177.1.33586 WP_000561177.1.33592 WP_000561177.1.33609 WP_000561177.1.33629 WP_000561177.1.3364 WP_000561177.1.33659 WP_000561177.1.33689 WP_000561177.1.3370 WP_000561177.1.33730 WP_000561177.1.33741 WP_000561177.1.33786 WP_000561177.1.33825 WP_000561177.1.33840 WP_000561177.1.33894 WP_000561177.1.3392 WP_000561177.1.33926 WP_000561177.1.3394 WP_000561177.1.3395 WP_000561177.1.33957 WP_000561177.1.3396 WP_000561177.1.33969 WP_000561177.1.33986 WP_000561177.1.34 WP_000561177.1.34001 WP_000561177.1.34022 WP_000561177.1.34043 WP_000561177.1.34059 WP_000561177.1.34075 WP_000561177.1.34081 WP_000561177.1.34084 WP_000561177.1.34091 WP_000561177.1.34107 WP_000561177.1.34118 WP_000561177.1.34179 WP_000561177.1.34184 WP_000561177.1.34185 WP_000561177.1.34211 WP_000561177.1.34214 WP_000561177.1.34234 WP_000561177.1.34257 WP_000561177.1.34259 WP_000561177.1.34279 WP_000561177.1.34284 WP_000561177.1.34292 WP_000561177.1.34304 WP_000561177.1.34319 WP_000561177.1.34330 WP_000561177.1.34376 WP_000561177.1.3438 WP_000561177.1.34382 WP_000561177.1.34417 WP_000561177.1.34431 WP_000561177.1.3445 WP_000561177.1.34453 WP_000561177.1.34454 WP_000561177.1.34458 WP_000561177.1.34484 WP_000561177.1.34496 WP_000561177.1.34517 WP_000561177.1.34530 WP_000561177.1.34614 WP_000561177.1.34647 WP_000561177.1.34659 WP_000561177.1.34665 WP_000561177.1.34667 WP_000561177.1.34694 WP_000561177.1.34704 WP_000561177.1.34711 WP_000561177.1.34745 WP_000561177.1.34751 WP_000561177.1.34808 WP_000561177.1.34817 WP_000561177.1.34820 WP_000561177.1.34824 WP_000561177.1.34834 WP_000561177.1.34854 WP_000561177.1.34881 WP_000561177.1.3489 WP_000561177.1.34932 WP_000561177.1.34962 WP_000561177.1.34972 WP_000561177.1.34975 WP_000561177.1.34977 WP_000561177.1.35001 WP_000561177.1.35035 WP_000561177.1.35040 WP_000561177.1.35045 WP_000561177.1.35074 WP_000561177.1.35075 WP_000561177.1.35125 WP_000561177.1.35129 WP_000561177.1.35175 WP_000561177.1.35184 WP_000561177.1.35193 WP_000561177.1.35240 WP_000561177.1.35274 WP_000561177.1.35294 WP_000561177.1.35298 WP_000561177.1.35321 WP_000561177.1.35371 WP_000561177.1.35404 WP_000561177.1.35408 WP_000561177.1.3541 WP_000561177.1.35425 WP_000561177.1.35429 WP_000561177.1.35446 WP_000561177.1.35460 WP_000561177.1.35463 WP_000561177.1.35494 WP_000561177.1.35503 WP_000561177.1.35509 WP_000561177.1.35532 WP_000561177.1.3556 WP_000561177.1.35560 WP_000561177.1.35563 WP_000561177.1.3557 WP_000561177.1.35570 WP_000561177.1.35575 WP_000561177.1.35590 WP_000561177.1.35594 WP_000561177.1.35624 WP_000561177.1.35628 WP_000561177.1.35648 WP_000561177.1.3566 WP_000561177.1.3570 WP_000561177.1.35712 WP_000561177.1.35713 WP_000561177.1.35736 WP_000561177.1.35777 WP_000561177.1.35791 WP_000561177.1.35795 WP_000561177.1.35809 WP_000561177.1.35835 WP_000561177.1.35868 WP_000561177.1.35870 WP_000561177.1.35887 WP_000561177.1.35892 WP_000561177.1.35916 WP_000561177.1.35936 WP_000561177.1.35938 WP_000561177.1.35940 WP_000561177.1.35961 WP_000561177.1.35966 WP_000561177.1.35993 WP_000561177.1.36000 WP_000561177.1.36003 WP_000561177.1.3601 WP_000561177.1.36011 WP_000561177.1.36017 WP_000561177.1.36034 WP_000561177.1.36036 WP_000561177.1.36037 WP_000561177.1.36063 WP_000561177.1.36069 WP_000561177.1.3610 WP_000561177.1.36157 WP_000561177.1.36172 WP_000561177.1.36229 WP_000561177.1.36232 WP_000561177.1.36236 WP_000561177.1.36286 WP_000561177.1.36291 WP_000561177.1.36298 WP_000561177.1.36308 WP_000561177.1.36323 WP_000561177.1.36343 WP_000561177.1.36409 WP_000561177.1.36425 WP_000561177.1.36445 WP_000561177.1.36460 WP_000561177.1.3649 WP_000561177.1.36495 WP_000561177.1.36512 WP_000561177.1.36526 WP_000561177.1.36542 WP_000561177.1.36547 WP_000561177.1.36564 WP_000561177.1.36567 WP_000561177.1.36579 WP_000561177.1.36584 WP_000561177.1.36592 WP_000561177.1.36609 WP_000561177.1.36617 WP_000561177.1.36618 WP_000561177.1.36643 WP_000561177.1.36652 WP_000561177.1.36663 WP_000561177.1.36685 WP_000561177.1.36690 WP_000561177.1.3670 WP_000561177.1.36701 WP_000561177.1.36705 WP_000561177.1.36721 WP_000561177.1.36725 WP_000561177.1.36764 WP_000561177.1.36765 WP_000561177.1.36779 WP_000561177.1.36792 WP_000561177.1.36798 WP_000561177.1.36802 WP_000561177.1.36821 WP_000561177.1.36853 WP_000561177.1.3688 WP_000561177.1.36885 WP_000561177.1.36889 WP_000561177.1.36899 WP_000561177.1.36918 WP_000561177.1.36931 WP_000561177.1.36948 WP_000561177.1.36949 WP_000561177.1.36950 WP_000561177.1.36978 WP_000561177.1.37013 WP_000561177.1.37014 WP_000561177.1.37021 WP_000561177.1.37028 WP_000561177.1.37029 WP_000561177.1.37063 WP_000561177.1.37073 WP_000561177.1.37100 WP_000561177.1.37111 WP_000561177.1.37112 WP_000561177.1.37114 WP_000561177.1.37119 WP_000561177.1.37133 WP_000561177.1.37147 WP_000561177.1.37158 WP_000561177.1.37176 WP_000561177.1.37191 WP_000561177.1.37199 WP_000561177.1.37200 WP_000561177.1.37256 WP_000561177.1.37258 WP_000561177.1.37267 WP_000561177.1.3728 WP_000561177.1.37293 WP_000561177.1.37297 WP_000561177.1.37303 WP_000561177.1.37320 WP_000561177.1.37363 WP_000561177.1.37370 WP_000561177.1.37376 WP_000561177.1.37405 WP_000561177.1.3741 WP_000561177.1.3744 WP_000561177.1.37478 WP_000561177.1.3748 WP_000561177.1.37498 WP_000561177.1.37504 WP_000561177.1.37513 WP_000561177.1.37521 WP_000561177.1.37558 WP_000561177.1.3756 WP_000561177.1.37584 WP_000561177.1.37590 WP_000561177.1.37593 WP_000561177.1.37600 WP_000561177.1.37610 WP_000561177.1.37613 WP_000561177.1.37618 WP_000561177.1.37659 WP_000561177.1.37662 WP_000561177.1.37666 WP_000561177.1.37675 WP_000561177.1.37687 WP_000561177.1.37691 WP_000561177.1.3771 WP_000561177.1.37719 WP_000561177.1.37761 WP_000561177.1.37775 WP_000561177.1.37777 WP_000561177.1.3778 WP_000561177.1.378 WP_000561177.1.37808 WP_000561177.1.37848 WP_000561177.1.37864 WP_000561177.1.379 WP_000561177.1.3790 WP_000561177.1.37911 WP_000561177.1.37941 WP_000561177.1.37965 WP_000561177.1.37968 WP_000561177.1.37978 WP_000561177.1.37985 WP_000561177.1.38001 WP_000561177.1.38026 WP_000561177.1.38037 WP_000561177.1.38047 WP_000561177.1.38055 WP_000561177.1.38061 WP_000561177.1.38064 WP_000561177.1.38108 WP_000561177.1.38113 WP_000561177.1.38125 WP_000561177.1.38145 WP_000561177.1.3816 WP_000561177.1.38199 WP_000561177.1.38207 WP_000561177.1.38261 WP_000561177.1.38266 WP_000561177.1.38273 WP_000561177.1.3828 WP_000561177.1.383 WP_000561177.1.38310 WP_000561177.1.3834 WP_000561177.1.38341 WP_000561177.1.38344 WP_000561177.1.38351 WP_000561177.1.3838 WP_000561177.1.38381 WP_000561177.1.38393 WP_000561177.1.38408 WP_000561177.1.38440 WP_000561177.1.3848 WP_000561177.1.38486 WP_000561177.1.38515 WP_000561177.1.38569 WP_000561177.1.38595 WP_000561177.1.3860 WP_000561177.1.38613 WP_000561177.1.38642 WP_000561177.1.38673 WP_000561177.1.3869 WP_000561177.1.38693 WP_000561177.1.38734 WP_000561177.1.38740 WP_000561177.1.38773 WP_000561177.1.38781 WP_000561177.1.38797 WP_000561177.1.38857 WP_000561177.1.38877 WP_000561177.1.38881 WP_000561177.1.38882 WP_000561177.1.38886 WP_000561177.1.38895 WP_000561177.1.38898 WP_000561177.1.38913 WP_000561177.1.38942 WP_000561177.1.38983 WP_000561177.1.38995 WP_000561177.1.38996 WP_000561177.1.39003 WP_000561177.1.39038 WP_000561177.1.39048 WP_000561177.1.39055 WP_000561177.1.39056 WP_000561177.1.39059 WP_000561177.1.39065 WP_000561177.1.3907 WP_000561177.1.39075 WP_000561177.1.39082 WP_000561177.1.39105 WP_000561177.1.39113 WP_000561177.1.39136 WP_000561177.1.3914 WP_000561177.1.39140 WP_000561177.1.39146 WP_000561177.1.39147 WP_000561177.1.39161 WP_000561177.1.39183 WP_000561177.1.39197 WP_000561177.1.39210 WP_000561177.1.39229 WP_000561177.1.39235 WP_000561177.1.39265 WP_000561177.1.3931 WP_000561177.1.39311 WP_000561177.1.39312 WP_000561177.1.39385 WP_000561177.1.39395 WP_000561177.1.39405 WP_000561177.1.39420 WP_000561177.1.39435 WP_000561177.1.39449 WP_000561177.1.39466 WP_000561177.1.39471 WP_000561177.1.39497 WP_000561177.1.39502 WP_000561177.1.39503 WP_000561177.1.39512 WP_000561177.1.39530 WP_000561177.1.39553 WP_000561177.1.39556 WP_000561177.1.39576 WP_000561177.1.39584 WP_000561177.1.39609 WP_000561177.1.39619 WP_000561177.1.39620 WP_000561177.1.39624 WP_000561177.1.39629 WP_000561177.1.39632 WP_000561177.1.39659 WP_000561177.1.39667 WP_000561177.1.39722 WP_000561177.1.39723 WP_000561177.1.39724 WP_000561177.1.39763 WP_000561177.1.39775 WP_000561177.1.39862 WP_000561177.1.39879 WP_000561177.1.39890 WP_000561177.1.39921 WP_000561177.1.39923 WP_000561177.1.39941 WP_000561177.1.39945 WP_000561177.1.39947 WP_000561177.1.40008 WP_000561177.1.40017 WP_000561177.1.40072 WP_000561177.1.40073 WP_000561177.1.40081 WP_000561177.1.40095 WP_000561177.1.40097 WP_000561177.1.401 WP_000561177.1.4011 WP_000561177.1.40111 WP_000561177.1.40155 WP_000561177.1.40160 WP_000561177.1.40167 WP_000561177.1.40170 WP_000561177.1.40171 WP_000561177.1.40205 WP_000561177.1.40208 WP_000561177.1.40224 WP_000561177.1.40229 WP_000561177.1.40240 WP_000561177.1.40254 WP_000561177.1.40257 WP_000561177.1.40258 WP_000561177.1.40279 WP_000561177.1.40292 WP_000561177.1.40305 WP_000561177.1.40307 WP_000561177.1.40311 WP_000561177.1.40341 WP_000561177.1.40361 WP_000561177.1.4037 WP_000561177.1.40374 WP_000561177.1.40395 WP_000561177.1.4042 WP_000561177.1.40465 WP_000561177.1.40467 WP_000561177.1.40492 WP_000561177.1.40493 WP_000561177.1.40496 WP_000561177.1.40508 WP_000561177.1.40517 WP_000561177.1.40528 WP_000561177.1.40533 WP_000561177.1.40577 WP_000561177.1.40583 WP_000561177.1.40605 WP_000561177.1.40622 WP_000561177.1.40648 WP_000561177.1.40693 WP_000561177.1.40695 WP_000561177.1.40698 WP_000561177.1.40710 WP_000561177.1.40745 WP_000561177.1.4075 WP_000561177.1.40750 WP_000561177.1.40763 WP_000561177.1.40771 WP_000561177.1.40788 WP_000561177.1.40849 WP_000561177.1.40854 WP_000561177.1.4087 WP_000561177.1.40877 WP_000561177.1.4088 WP_000561177.1.4089 WP_000561177.1.40910 WP_000561177.1.40924 WP_000561177.1.40930 WP_000561177.1.40932 WP_000561177.1.40946 WP_000561177.1.40973 WP_000561177.1.40979 WP_000561177.1.40996 WP_000561177.1.41004 WP_000561177.1.41017 WP_000561177.1.41018 WP_000561177.1.41048 WP_000561177.1.41050 WP_000561177.1.4106 WP_000561177.1.41070 WP_000561177.1.41074 WP_000561177.1.41075 WP_000561177.1.41086 WP_000561177.1.4109 WP_000561177.1.41091 WP_000561177.1.41097 WP_000561177.1.41116 WP_000561177.1.41128 WP_000561177.1.41132 WP_000561177.1.41176 WP_000561177.1.41192 WP_000561177.1.41225 WP_000561177.1.41226 WP_000561177.1.41251 WP_000561177.1.41258 WP_000561177.1.41265 WP_000561177.1.41277 WP_000561177.1.41279 WP_000561177.1.41299 WP_000561177.1.41305 WP_000561177.1.41308 WP_000561177.1.41310 WP_000561177.1.41321 WP_000561177.1.41333 WP_000561177.1.41335 WP_000561177.1.41345 WP_000561177.1.4136 WP_000561177.1.41375 WP_000561177.1.41415 WP_000561177.1.41427 WP_000561177.1.41438 WP_000561177.1.41440 WP_000561177.1.41459 WP_000561177.1.41468 WP_000561177.1.41498 WP_000561177.1.41516 WP_000561177.1.41519 WP_000561177.1.41524 WP_000561177.1.41528 WP_000561177.1.41554 WP_000561177.1.41591 WP_000561177.1.41593 WP_000561177.1.41610 WP_000561177.1.41628 WP_000561177.1.41631 WP_000561177.1.41658 WP_000561177.1.41659 WP_000561177.1.41662 WP_000561177.1.41688 WP_000561177.1.41690 WP_000561177.1.41708 WP_000561177.1.41716 WP_000561177.1.41724 WP_000561177.1.41735 WP_000561177.1.41746 WP_000561177.1.41761 WP_000561177.1.4178 WP_000561177.1.41789 WP_000561177.1.41799 WP_000561177.1.41824 WP_000561177.1.41825 WP_000561177.1.41836 WP_000561177.1.4184 WP_000561177.1.41859 WP_000561177.1.41862 WP_000561177.1.41877 WP_000561177.1.41882 WP_000561177.1.41894 WP_000561177.1.41897 WP_000561177.1.41911 WP_000561177.1.41919 WP_000561177.1.41929 WP_000561177.1.41931 WP_000561177.1.41938 WP_000561177.1.4194 WP_000561177.1.41949 WP_000561177.1.41978 WP_000561177.1.41979 WP_000561177.1.41985 WP_000561177.1.41994 WP_000561177.1.41998 WP_000561177.1.42009 WP_000561177.1.42069 WP_000561177.1.42081 WP_000561177.1.42090 WP_000561177.1.42104 WP_000561177.1.42111 WP_000561177.1.42136 WP_000561177.1.42156 WP_000561177.1.42187 WP_000561177.1.422 WP_000561177.1.42200 WP_000561177.1.42219 WP_000561177.1.4222 WP_000561177.1.42238 WP_000561177.1.42243 WP_000561177.1.42248 WP_000561177.1.42257 WP_000561177.1.42261 WP_000561177.1.42262 WP_000561177.1.42263 WP_000561177.1.42276 WP_000561177.1.42320 WP_000561177.1.42322 WP_000561177.1.42328 WP_000561177.1.42342 WP_000561177.1.42349 WP_000561177.1.42356 WP_000561177.1.42364 WP_000561177.1.42371 WP_000561177.1.42379 WP_000561177.1.4239 WP_000561177.1.42391 WP_000561177.1.42392 WP_000561177.1.42394 WP_000561177.1.42399 WP_000561177.1.42404 WP_000561177.1.42422 WP_000561177.1.42444 WP_000561177.1.42453 WP_000561177.1.42489 WP_000561177.1.42491 WP_000561177.1.42539 WP_000561177.1.4257 WP_000561177.1.42603 WP_000561177.1.42605 WP_000561177.1.42650 WP_000561177.1.42666 WP_000561177.1.4267 WP_000561177.1.42675 WP_000561177.1.42676 WP_000561177.1.42683 WP_000561177.1.42685 WP_000561177.1.42701 WP_000561177.1.42707 WP_000561177.1.42734 WP_000561177.1.4276 WP_000561177.1.42767 WP_000561177.1.42797 WP_000561177.1.42805 WP_000561177.1.42815 WP_000561177.1.42829 WP_000561177.1.42859 WP_000561177.1.42861 WP_000561177.1.42864 WP_000561177.1.4288 WP_000561177.1.42887 WP_000561177.1.4289 WP_000561177.1.42892 WP_000561177.1.42923 WP_000561177.1.42932 WP_000561177.1.42957 WP_000561177.1.42978 WP_000561177.1.4298 WP_000561177.1.42981 WP_000561177.1.43008 WP_000561177.1.43016 WP_000561177.1.43018 WP_000561177.1.43019 WP_000561177.1.43041 WP_000561177.1.43065 WP_000561177.1.43068 WP_000561177.1.43069 WP_000561177.1.43070 WP_000561177.1.43077 WP_000561177.1.43089 WP_000561177.1.43126 WP_000561177.1.43128 WP_000561177.1.43141 WP_000561177.1.43149 WP_000561177.1.43157 WP_000561177.1.43160 WP_000561177.1.43161 WP_000561177.1.43190 WP_000561177.1.43198 WP_000561177.1.43201 WP_000561177.1.43244 WP_000561177.1.43258 WP_000561177.1.4326 WP_000561177.1.43276 WP_000561177.1.43290 WP_000561177.1.43292 WP_000561177.1.43299 WP_000561177.1.43307 WP_000561177.1.43312 WP_000561177.1.4332 WP_000561177.1.43339 WP_000561177.1.43351 WP_000561177.1.43371 WP_000561177.1.43437 WP_000561177.1.43438 WP_000561177.1.4344 WP_000561177.1.43441 WP_000561177.1.43476 WP_000561177.1.43508 WP_000561177.1.43513 WP_000561177.1.43522 WP_000561177.1.43528 WP_000561177.1.43535 WP_000561177.1.43606 WP_000561177.1.43613 WP_000561177.1.43633 WP_000561177.1.43637 WP_000561177.1.43651 WP_000561177.1.43654 WP_000561177.1.43668 WP_000561177.1.43676 WP_000561177.1.43685 WP_000561177.1.43710 WP_000561177.1.43711 WP_000561177.1.43722 WP_000561177.1.4373 WP_000561177.1.43763 WP_000561177.1.43778 WP_000561177.1.43782 WP_000561177.1.43785 WP_000561177.1.43801 WP_000561177.1.43812 WP_000561177.1.43828 WP_000561177.1.43873 WP_000561177.1.43875 WP_000561177.1.43878 WP_000561177.1.43886 WP_000561177.1.43888 WP_000561177.1.43919 WP_000561177.1.43951 WP_000561177.1.43954 WP_000561177.1.43974 WP_000561177.1.44005 WP_000561177.1.44010 WP_000561177.1.4404 WP_000561177.1.44043 WP_000561177.1.44049 WP_000561177.1.4405 WP_000561177.1.44063 WP_000561177.1.44099 WP_000561177.1.44101 WP_000561177.1.44113 WP_000561177.1.44121 WP_000561177.1.44132 WP_000561177.1.44160 WP_000561177.1.44180 WP_000561177.1.44196 WP_000561177.1.44208 WP_000561177.1.4422 WP_000561177.1.4423 WP_000561177.1.44248 WP_000561177.1.44250 WP_000561177.1.44262 WP_000561177.1.44268 WP_000561177.1.4427 WP_000561177.1.44291 WP_000561177.1.44296 WP_000561177.1.44300 WP_000561177.1.44310 WP_000561177.1.44337 WP_000561177.1.44339 WP_000561177.1.44343 WP_000561177.1.44351 WP_000561177.1.44359 WP_000561177.1.44360 WP_000561177.1.44380 WP_000561177.1.44386 WP_000561177.1.4440 WP_000561177.1.44416 WP_000561177.1.44431 WP_000561177.1.44433 WP_000561177.1.44437 WP_000561177.1.44440 WP_000561177.1.44443 WP_000561177.1.44453 WP_000561177.1.44474 WP_000561177.1.44479 WP_000561177.1.44546 WP_000561177.1.44549 WP_000561177.1.44578 WP_000561177.1.44593 WP_000561177.1.44607 WP_000561177.1.44633 WP_000561177.1.44636 WP_000561177.1.44640 WP_000561177.1.4467 WP_000561177.1.44678 WP_000561177.1.4468 WP_000561177.1.44702 WP_000561177.1.44705 WP_000561177.1.44747 WP_000561177.1.44762 WP_000561177.1.44781 WP_000561177.1.44791 WP_000561177.1.44795 WP_000561177.1.44815 WP_000561177.1.44828 WP_000561177.1.44831 WP_000561177.1.44833 WP_000561177.1.4485 WP_000561177.1.44877 WP_000561177.1.44879 WP_000561177.1.44887 WP_000561177.1.449 WP_000561177.1.44917 WP_000561177.1.44927 WP_000561177.1.44933 WP_000561177.1.44943 WP_000561177.1.44950 WP_000561177.1.44966 WP_000561177.1.44971 WP_000561177.1.44978 WP_000561177.1.44985 WP_000561177.1.44996 WP_000561177.1.44997 WP_000561177.1.4500 WP_000561177.1.4501 WP_000561177.1.45027 WP_000561177.1.45045 WP_000561177.1.45067 WP_000561177.1.45072 WP_000561177.1.45074 WP_000561177.1.45079 WP_000561177.1.45093 WP_000561177.1.45098 WP_000561177.1.45123 WP_000561177.1.45134 WP_000561177.1.45136 WP_000561177.1.45138 WP_000561177.1.45145 WP_000561177.1.45154 WP_000561177.1.45173 WP_000561177.1.45177 WP_000561177.1.45184 WP_000561177.1.45241 WP_000561177.1.45251 WP_000561177.1.45259 WP_000561177.1.45268 WP_000561177.1.45302 WP_000561177.1.4531 WP_000561177.1.45322 WP_000561177.1.45344 WP_000561177.1.45349 WP_000561177.1.45351 WP_000561177.1.45365 WP_000561177.1.4540 WP_000561177.1.45402 WP_000561177.1.45432 WP_000561177.1.45434 WP_000561177.1.45435 WP_000561177.1.45462 WP_000561177.1.45468 WP_000561177.1.45522 WP_000561177.1.45523 WP_000561177.1.45544 WP_000561177.1.45549 WP_000561177.1.45550 WP_000561177.1.45566 WP_000561177.1.45569 WP_000561177.1.45571 WP_000561177.1.45582 WP_000561177.1.45583 WP_000561177.1.45585 WP_000561177.1.45596 WP_000561177.1.45622 WP_000561177.1.45648 WP_000561177.1.45660 WP_000561177.1.45690 WP_000561177.1.45706 WP_000561177.1.45781 WP_000561177.1.45797 WP_000561177.1.458 WP_000561177.1.45829 WP_000561177.1.45844 WP_000561177.1.45848 WP_000561177.1.45871 WP_000561177.1.45906 WP_000561177.1.45918 WP_000561177.1.45943 WP_000561177.1.45984 WP_000561177.1.46011 WP_000561177.1.46028 WP_000561177.1.46030 WP_000561177.1.46069 WP_000561177.1.46077 WP_000561177.1.46091 WP_000561177.1.46112 WP_000561177.1.46124 WP_000561177.1.46169 WP_000561177.1.46173 WP_000561177.1.46174 WP_000561177.1.46187 WP_000561177.1.46205 WP_000561177.1.46215 WP_000561177.1.46225 WP_000561177.1.46232 WP_000561177.1.46241 WP_000561177.1.46243 WP_000561177.1.46250 WP_000561177.1.46278 WP_000561177.1.46286 WP_000561177.1.46299 WP_000561177.1.46303 WP_000561177.1.46307 WP_000561177.1.46323 WP_000561177.1.46345 WP_000561177.1.46355 WP_000561177.1.46358 WP_000561177.1.464 WP_000561177.1.46406 WP_000561177.1.46434 WP_000561177.1.46454 WP_000561177.1.46461 WP_000561177.1.46499 WP_000561177.1.46504 WP_000561177.1.46505 WP_000561177.1.46551 WP_000561177.1.46559 WP_000561177.1.46572 WP_000561177.1.46574 WP_000561177.1.46578 WP_000561177.1.46595 WP_000561177.1.46620 WP_000561177.1.46637 WP_000561177.1.46666 WP_000561177.1.46675 WP_000561177.1.46689 WP_000561177.1.46693 WP_000561177.1.46701 WP_000561177.1.4671 WP_000561177.1.46726 WP_000561177.1.46730 WP_000561177.1.46732 WP_000561177.1.4674 WP_000561177.1.46749 WP_000561177.1.46781 WP_000561177.1.46803 WP_000561177.1.46804 WP_000561177.1.46816 WP_000561177.1.46842 WP_000561177.1.4686 WP_000561177.1.4690 WP_000561177.1.46920 WP_000561177.1.46930 WP_000561177.1.46945 WP_000561177.1.46961 WP_000561177.1.46967 WP_000561177.1.46976 WP_000561177.1.47005 WP_000561177.1.47008 WP_000561177.1.47014 WP_000561177.1.47036 WP_000561177.1.47037 WP_000561177.1.47042 WP_000561177.1.47057 WP_000561177.1.47058 WP_000561177.1.47059 WP_000561177.1.47067 WP_000561177.1.47085 WP_000561177.1.47123 WP_000561177.1.47214 WP_000561177.1.47215 WP_000561177.1.47245 WP_000561177.1.47257 WP_000561177.1.47429 WP_000561177.1.47442 WP_000561177.1.47448 WP_000561177.1.47460 WP_000561177.1.4747 WP_000561177.1.47472 WP_000561177.1.47478 WP_000561177.1.47482 WP_000561177.1.47506 WP_000561177.1.47507 WP_000561177.1.47523 WP_000561177.1.47531 WP_000561177.1.47532 WP_000561177.1.47567 WP_000561177.1.47576 WP_000561177.1.47579 WP_000561177.1.4758 WP_000561177.1.47587 WP_000561177.1.47605 WP_000561177.1.47614 WP_000561177.1.47621 WP_000561177.1.47630 WP_000561177.1.4769 WP_000561177.1.4770 WP_000561177.1.4774 WP_000561177.1.4775 WP_000561177.1.47756 WP_000561177.1.47767 WP_000561177.1.47799 WP_000561177.1.4781 WP_000561177.1.47814 WP_000561177.1.47817 WP_000561177.1.47829 WP_000561177.1.47849 WP_000561177.1.47850 WP_000561177.1.47875 WP_000561177.1.47898 WP_000561177.1.47902 WP_000561177.1.47911 WP_000561177.1.47928 WP_000561177.1.4795 WP_000561177.1.47988 WP_000561177.1.47992 WP_000561177.1.48019 WP_000561177.1.48033 WP_000561177.1.48100 WP_000561177.1.48114 WP_000561177.1.48124 WP_000561177.1.48132 WP_000561177.1.48139 WP_000561177.1.48190 WP_000561177.1.48209 WP_000561177.1.48215 WP_000561177.1.48218 WP_000561177.1.48242 WP_000561177.1.48244 WP_000561177.1.48247 WP_000561177.1.48253 WP_000561177.1.48262 WP_000561177.1.48292 WP_000561177.1.483 WP_000561177.1.48324 WP_000561177.1.48342 WP_000561177.1.48367 WP_000561177.1.48377 WP_000561177.1.4839 WP_000561177.1.48399 WP_000561177.1.48426 WP_000561177.1.48430 WP_000561177.1.48436 WP_000561177.1.48455 WP_000561177.1.48493 WP_000561177.1.4853 WP_000561177.1.48570 WP_000561177.1.48586 WP_000561177.1.4859 WP_000561177.1.48591 WP_000561177.1.48610 WP_000561177.1.48631 WP_000561177.1.48647 WP_000561177.1.48651 WP_000561177.1.48663 WP_000561177.1.48690 WP_000561177.1.48734 WP_000561177.1.48751 WP_000561177.1.48755 WP_000561177.1.48756 WP_000561177.1.48774 WP_000561177.1.48778 WP_000561177.1.48788 WP_000561177.1.48797 WP_000561177.1.48849 WP_000561177.1.48855 WP_000561177.1.48876 WP_000561177.1.48886 WP_000561177.1.48894 WP_000561177.1.48896 WP_000561177.1.48908 WP_000561177.1.48919 WP_000561177.1.48955 WP_000561177.1.48963 WP_000561177.1.48973 WP_000561177.1.48985 WP_000561177.1.49004 WP_000561177.1.49005 WP_000561177.1.49012 WP_000561177.1.49084 WP_000561177.1.49090 WP_000561177.1.49102 WP_000561177.1.49106 WP_000561177.1.49113 WP_000561177.1.49117 WP_000561177.1.49121 WP_000561177.1.4914 WP_000561177.1.49140 WP_000561177.1.49153 WP_000561177.1.49155 WP_000561177.1.49162 WP_000561177.1.49166 WP_000561177.1.49175 WP_000561177.1.49204 WP_000561177.1.49214 WP_000561177.1.49226 WP_000561177.1.49239 WP_000561177.1.49256 WP_000561177.1.49262 WP_000561177.1.49276 WP_000561177.1.49290 WP_000561177.1.49304 WP_000561177.1.49309 WP_000561177.1.49311 WP_000561177.1.49334 WP_000561177.1.49340 WP_000561177.1.49355 WP_000561177.1.49358 WP_000561177.1.49366 WP_000561177.1.49375 WP_000561177.1.49429 WP_000561177.1.49434 WP_000561177.1.49443 WP_000561177.1.49450 WP_000561177.1.49472 WP_000561177.1.49490 WP_000561177.1.495 WP_000561177.1.49515 WP_000561177.1.49534 WP_000561177.1.49545 WP_000561177.1.49550 WP_000561177.1.49572 WP_000561177.1.49574 WP_000561177.1.49590 WP_000561177.1.49595 WP_000561177.1.49602 WP_000561177.1.49626 WP_000561177.1.49630 WP_000561177.1.49647 WP_000561177.1.49650 WP_000561177.1.49686 WP_000561177.1.49703 WP_000561177.1.49710 WP_000561177.1.49769 WP_000561177.1.49770 WP_000561177.1.49778 WP_000561177.1.4979 WP_000561177.1.49803 WP_000561177.1.49805 WP_000561177.1.49827 WP_000561177.1.49846 WP_000561177.1.49848 WP_000561177.1.4991 WP_000561177.1.49929 WP_000561177.1.49947 WP_000561177.1.49959 WP_000561177.1.49997 WP_000561177.1.50003 WP_000561177.1.50007 WP_000561177.1.50014 WP_000561177.1.50030 WP_000561177.1.50043 WP_000561177.1.50080 WP_000561177.1.5009 WP_000561177.1.50103 WP_000561177.1.50128 WP_000561177.1.50158 WP_000561177.1.50161 WP_000561177.1.50198 WP_000561177.1.50211 WP_000561177.1.50238 WP_000561177.1.50239 WP_000561177.1.50247 WP_000561177.1.50251 WP_000561177.1.50308 WP_000561177.1.50309 WP_000561177.1.50332 WP_000561177.1.50349 WP_000561177.1.50374 WP_000561177.1.50376 WP_000561177.1.50386 WP_000561177.1.50387 WP_000561177.1.50389 WP_000561177.1.50404 WP_000561177.1.50406 WP_000561177.1.50449 WP_000561177.1.50468 WP_000561177.1.50469 WP_000561177.1.50478 WP_000561177.1.50480 WP_000561177.1.50497 WP_000561177.1.5051 WP_000561177.1.50517 WP_000561177.1.50563 WP_000561177.1.50566 WP_000561177.1.50570 WP_000561177.1.50576 WP_000561177.1.5058 WP_000561177.1.50593 WP_000561177.1.50626 WP_000561177.1.50652 WP_000561177.1.50676 WP_000561177.1.50684 WP_000561177.1.50726 WP_000561177.1.50769 WP_000561177.1.50771 WP_000561177.1.50774 WP_000561177.1.50777 WP_000561177.1.50782 WP_000561177.1.50800 WP_000561177.1.50804 WP_000561177.1.50808 WP_000561177.1.50811 WP_000561177.1.50875 WP_000561177.1.5088 WP_000561177.1.50882 WP_000561177.1.50885 WP_000561177.1.50893 WP_000561177.1.509 WP_000561177.1.50908 WP_000561177.1.50918 WP_000561177.1.50929 WP_000561177.1.50941 WP_000561177.1.50954 WP_000561177.1.50960 WP_000561177.1.50970 WP_000561177.1.50999 WP_000561177.1.51014 WP_000561177.1.51022 WP_000561177.1.51025 WP_000561177.1.51036 WP_000561177.1.51040 WP_000561177.1.51048 WP_000561177.1.51066 WP_000561177.1.51100 WP_000561177.1.51117 WP_000561177.1.51131 WP_000561177.1.51134 WP_000561177.1.51139 WP_000561177.1.5114 WP_000561177.1.51162 WP_000561177.1.51178 WP_000561177.1.51179 WP_000561177.1.51182 WP_000561177.1.51186 WP_000561177.1.51224 WP_000561177.1.51227 WP_000561177.1.5125 WP_000561177.1.5127 WP_000561177.1.51285 WP_000561177.1.51305 WP_000561177.1.51308 WP_000561177.1.51315 WP_000561177.1.51331 WP_000561177.1.51338 WP_000561177.1.51356 WP_000561177.1.5136 WP_000561177.1.5138 WP_000561177.1.51394 WP_000561177.1.51412 WP_000561177.1.51414 WP_000561177.1.51419 WP_000561177.1.51451 WP_000561177.1.51474 WP_000561177.1.51487 WP_000561177.1.51488 WP_000561177.1.51502 WP_000561177.1.51506 WP_000561177.1.51514 WP_000561177.1.51519 WP_000561177.1.51555 WP_000561177.1.51598 WP_000561177.1.51611 WP_000561177.1.51613 WP_000561177.1.51615 WP_000561177.1.51634 WP_000561177.1.51642 WP_000561177.1.51644 WP_000561177.1.51649 WP_000561177.1.51686 WP_000561177.1.51700 WP_000561177.1.51704 WP_000561177.1.51724 WP_000561177.1.51734 WP_000561177.1.51756 WP_000561177.1.51764 WP_000561177.1.51810 WP_000561177.1.51831 WP_000561177.1.51838 WP_000561177.1.51863 WP_000561177.1.51868 WP_000561177.1.51900 WP_000561177.1.51910 WP_000561177.1.51911 WP_000561177.1.51914 WP_000561177.1.51930 WP_000561177.1.51932 WP_000561177.1.51935 WP_000561177.1.51989 WP_000561177.1.51994 WP_000561177.1.520 WP_000561177.1.52047 WP_000561177.1.52057 WP_000561177.1.5211 WP_000561177.1.52121 WP_000561177.1.52123 WP_000561177.1.52129 WP_000561177.1.52148 WP_000561177.1.52156 WP_000561177.1.5216 WP_000561177.1.52161 WP_000561177.1.52170 WP_000561177.1.52191 WP_000561177.1.52202 WP_000561177.1.52209 WP_000561177.1.52255 WP_000561177.1.52301 WP_000561177.1.52321 WP_000561177.1.52336 WP_000561177.1.52339 WP_000561177.1.52346 WP_000561177.1.52353 WP_000561177.1.52356 WP_000561177.1.52361 WP_000561177.1.52438 WP_000561177.1.52446 WP_000561177.1.52456 WP_000561177.1.52469 WP_000561177.1.52527 WP_000561177.1.52528 WP_000561177.1.52571 WP_000561177.1.52582 WP_000561177.1.52586 WP_000561177.1.526 WP_000561177.1.52608 WP_000561177.1.52637 WP_000561177.1.52647 WP_000561177.1.52653 WP_000561177.1.52656 WP_000561177.1.52675 WP_000561177.1.52692 WP_000561177.1.5273 WP_000561177.1.52738 WP_000561177.1.52742 WP_000561177.1.52743 WP_000561177.1.52744 WP_000561177.1.52773 WP_000561177.1.52795 WP_000561177.1.52807 WP_000561177.1.52824 WP_000561177.1.52833 WP_000561177.1.52851 WP_000561177.1.52857 WP_000561177.1.52858 WP_000561177.1.52866 WP_000561177.1.52887 WP_000561177.1.52898 WP_000561177.1.52915 WP_000561177.1.52924 WP_000561177.1.52949 WP_000561177.1.52985 WP_000561177.1.5301 WP_000561177.1.53016 WP_000561177.1.53092 WP_000561177.1.53100 WP_000561177.1.53107 WP_000561177.1.53119 WP_000561177.1.5313 WP_000561177.1.53141 WP_000561177.1.53151 WP_000561177.1.53154 WP_000561177.1.53158 WP_000561177.1.53159 WP_000561177.1.53179 WP_000561177.1.53190 WP_000561177.1.53198 WP_000561177.1.53210 WP_000561177.1.53233 WP_000561177.1.53234 WP_000561177.1.53272 WP_000561177.1.53274 WP_000561177.1.53286 WP_000561177.1.53307 WP_000561177.1.53315 WP_000561177.1.53316 WP_000561177.1.53321 WP_000561177.1.53328 WP_000561177.1.5333 WP_000561177.1.53362 WP_000561177.1.53368 WP_000561177.1.53375 WP_000561177.1.53385 WP_000561177.1.53406 WP_000561177.1.53436 WP_000561177.1.53450 WP_000561177.1.53454 WP_000561177.1.53466 WP_000561177.1.5349 WP_000561177.1.53529 WP_000561177.1.53534 WP_000561177.1.53540 WP_000561177.1.53543 WP_000561177.1.53555 WP_000561177.1.53559 WP_000561177.1.5356 WP_000561177.1.53567 WP_000561177.1.53571 WP_000561177.1.5358 WP_000561177.1.53664 WP_000561177.1.53675 WP_000561177.1.53692 WP_000561177.1.53694 WP_000561177.1.53696 WP_000561177.1.53723 WP_000561177.1.5374 WP_000561177.1.53750 WP_000561177.1.53757 WP_000561177.1.53772 WP_000561177.1.53778 WP_000561177.1.53781 WP_000561177.1.53790 WP_000561177.1.53800 WP_000561177.1.53812 WP_000561177.1.53814 WP_000561177.1.53815 WP_000561177.1.53839 WP_000561177.1.53892 WP_000561177.1.53896 WP_000561177.1.53898 WP_000561177.1.53902 WP_000561177.1.53905 WP_000561177.1.5392 WP_000561177.1.53935 WP_000561177.1.53958 WP_000561177.1.53961 WP_000561177.1.53981 WP_000561177.1.53984 WP_000561177.1.54033 WP_000561177.1.54061 WP_000561177.1.54075 WP_000561177.1.54082 WP_000561177.1.54085 WP_000561177.1.54132 WP_000561177.1.54136 WP_000561177.1.5415 WP_000561177.1.54159 WP_000561177.1.54170 WP_000561177.1.54175 WP_000561177.1.54196 WP_000561177.1.542 WP_000561177.1.54203 WP_000561177.1.54209 WP_000561177.1.54259 WP_000561177.1.54271 WP_000561177.1.54273 WP_000561177.1.54274 WP_000561177.1.54283 WP_000561177.1.5430 WP_000561177.1.54319 WP_000561177.1.54324 WP_000561177.1.54333 WP_000561177.1.54364 WP_000561177.1.54366 WP_000561177.1.54371 WP_000561177.1.54400 WP_000561177.1.54431 WP_000561177.1.54442 WP_000561177.1.54482 WP_000561177.1.54500 WP_000561177.1.54522 WP_000561177.1.54526 WP_000561177.1.54558 WP_000561177.1.5456 WP_000561177.1.54569 WP_000561177.1.54589 WP_000561177.1.5459 WP_000561177.1.54607 WP_000561177.1.54615 WP_000561177.1.54644 WP_000561177.1.54662 WP_000561177.1.54667 WP_000561177.1.54678 WP_000561177.1.54681 WP_000561177.1.54694 WP_000561177.1.54722 WP_000561177.1.54748 WP_000561177.1.54749 WP_000561177.1.54764 WP_000561177.1.54774 WP_000561177.1.5481 WP_000561177.1.54814 WP_000561177.1.54827 WP_000561177.1.54833 WP_000561177.1.54845 WP_000561177.1.5485 WP_000561177.1.54865 WP_000561177.1.54877 WP_000561177.1.5493 WP_000561177.1.54935 WP_000561177.1.54936 WP_000561177.1.54979 WP_000561177.1.54984 WP_000561177.1.54992 WP_000561177.1.55008 WP_000561177.1.55010 WP_000561177.1.55034 WP_000561177.1.55073 WP_000561177.1.55152 WP_000561177.1.55156 WP_000561177.1.55163 WP_000561177.1.55165 WP_000561177.1.55166 WP_000561177.1.5517 WP_000561177.1.55215 WP_000561177.1.55224 WP_000561177.1.5523 WP_000561177.1.5525 WP_000561177.1.5527 WP_000561177.1.55285 WP_000561177.1.55290 WP_000561177.1.55294 WP_000561177.1.55310 WP_000561177.1.55317 WP_000561177.1.55325 WP_000561177.1.55361 WP_000561177.1.55379 WP_000561177.1.5539 WP_000561177.1.55418 WP_000561177.1.55430 WP_000561177.1.55461 WP_000561177.1.55468 WP_000561177.1.55475 WP_000561177.1.55506 WP_000561177.1.5552 WP_000561177.1.55528 WP_000561177.1.55545 WP_000561177.1.5555 WP_000561177.1.55554 WP_000561177.1.55557 WP_000561177.1.55559 WP_000561177.1.5560 WP_000561177.1.55604 WP_000561177.1.55614 WP_000561177.1.55623 WP_000561177.1.55639 WP_000561177.1.55640 WP_000561177.1.55647 WP_000561177.1.55680 WP_000561177.1.55699 WP_000561177.1.55706 WP_000561177.1.5572 WP_000561177.1.55725 WP_000561177.1.55743 WP_000561177.1.55768 WP_000561177.1.5577 WP_000561177.1.55780 WP_000561177.1.55782 WP_000561177.1.55796 WP_000561177.1.55803 WP_000561177.1.55923 WP_000561177.1.55948 WP_000561177.1.55967 WP_000561177.1.55973 WP_000561177.1.55993 WP_000561177.1.55995 WP_000561177.1.56002 WP_000561177.1.56004 WP_000561177.1.56012 WP_000561177.1.56026 WP_000561177.1.56059 WP_000561177.1.56069 WP_000561177.1.56097 WP_000561177.1.56100 WP_000561177.1.56105 WP_000561177.1.56130 WP_000561177.1.56144 WP_000561177.1.56152 WP_000561177.1.56172 WP_000561177.1.5621 WP_000561177.1.56222 WP_000561177.1.56226 WP_000561177.1.56235 WP_000561177.1.56238 WP_000561177.1.56244 WP_000561177.1.56247 WP_000561177.1.56261 WP_000561177.1.56263 WP_000561177.1.56286 WP_000561177.1.56303 WP_000561177.1.56304 WP_000561177.1.56305 WP_000561177.1.56311 WP_000561177.1.5633 WP_000561177.1.56368 WP_000561177.1.56370 WP_000561177.1.56385 WP_000561177.1.56389 WP_000561177.1.56393 WP_000561177.1.56396 WP_000561177.1.56413 WP_000561177.1.56414 WP_000561177.1.56419 WP_000561177.1.56420 WP_000561177.1.56423 WP_000561177.1.56438 WP_000561177.1.56512 WP_000561177.1.56514 WP_000561177.1.56535 WP_000561177.1.56559 WP_000561177.1.56560 WP_000561177.1.56585 WP_000561177.1.56597 WP_000561177.1.56601 WP_000561177.1.56614 WP_000561177.1.56640 WP_000561177.1.56642 WP_000561177.1.56647 WP_000561177.1.56651 WP_000561177.1.56660 WP_000561177.1.56671 WP_000561177.1.5668 WP_000561177.1.56682 WP_000561177.1.56724 WP_000561177.1.56824 WP_000561177.1.56825 WP_000561177.1.56851 WP_000561177.1.56853 WP_000561177.1.56861 WP_000561177.1.56875 WP_000561177.1.56877 WP_000561177.1.56887 WP_000561177.1.56889 WP_000561177.1.56893 WP_000561177.1.56898 WP_000561177.1.56905 WP_000561177.1.56981 WP_000561177.1.57000 WP_000561177.1.57026 WP_000561177.1.57039 WP_000561177.1.57056 WP_000561177.1.57076 WP_000561177.1.57084 WP_000561177.1.57101 WP_000561177.1.5711 WP_000561177.1.57125 WP_000561177.1.57137 WP_000561177.1.57143 WP_000561177.1.57147 WP_000561177.1.57149 WP_000561177.1.57168 WP_000561177.1.57179 WP_000561177.1.57186 WP_000561177.1.57187 WP_000561177.1.57232 WP_000561177.1.57233 WP_000561177.1.57246 WP_000561177.1.57296 WP_000561177.1.57307 WP_000561177.1.57342 WP_000561177.1.57344 WP_000561177.1.57356 WP_000561177.1.57357 WP_000561177.1.57362 WP_000561177.1.57377 WP_000561177.1.57418 WP_000561177.1.57433 WP_000561177.1.57495 WP_000561177.1.57510 WP_000561177.1.57515 WP_000561177.1.57521 WP_000561177.1.57529 WP_000561177.1.57534 WP_000561177.1.57555 WP_000561177.1.57559 WP_000561177.1.57576 WP_000561177.1.57601 WP_000561177.1.57607 WP_000561177.1.57631 WP_000561177.1.57684 WP_000561177.1.57699 WP_000561177.1.57710 WP_000561177.1.57735 WP_000561177.1.5774 WP_000561177.1.57763 WP_000561177.1.57778 WP_000561177.1.57781 WP_000561177.1.57785 WP_000561177.1.57797 WP_000561177.1.57800 WP_000561177.1.5781 WP_000561177.1.57835 WP_000561177.1.57857 WP_000561177.1.57862 WP_000561177.1.57873 WP_000561177.1.57890 WP_000561177.1.57891 WP_000561177.1.57893 WP_000561177.1.57902 WP_000561177.1.57965 WP_000561177.1.57972 WP_000561177.1.57978 WP_000561177.1.58008 WP_000561177.1.5801 WP_000561177.1.58040 WP_000561177.1.58041 WP_000561177.1.58044 WP_000561177.1.58081 WP_000561177.1.5809 WP_000561177.1.58090 WP_000561177.1.58131 WP_000561177.1.58132 WP_000561177.1.58144 WP_000561177.1.58157 WP_000561177.1.58173 WP_000561177.1.58191 WP_000561177.1.58194 WP_000561177.1.58239 WP_000561177.1.58249 WP_000561177.1.58251 WP_000561177.1.58252 WP_000561177.1.58261 WP_000561177.1.58274 WP_000561177.1.5828 WP_000561177.1.58282 WP_000561177.1.58290 WP_000561177.1.58301 WP_000561177.1.58324 WP_000561177.1.58326 WP_000561177.1.58334 WP_000561177.1.58357 WP_000561177.1.58358 WP_000561177.1.5836 WP_000561177.1.58372 WP_000561177.1.58407 WP_000561177.1.58416 WP_000561177.1.58418 WP_000561177.1.58442 WP_000561177.1.58443 WP_000561177.1.58451 WP_000561177.1.58485 WP_000561177.1.58486 WP_000561177.1.58489 WP_000561177.1.58537 WP_000561177.1.5854 WP_000561177.1.58548 WP_000561177.1.58564 WP_000561177.1.58568 WP_000561177.1.5858 WP_000561177.1.58583 WP_000561177.1.58604 WP_000561177.1.58633 WP_000561177.1.58652 WP_000561177.1.58662 WP_000561177.1.58663 WP_000561177.1.58669 WP_000561177.1.58675 WP_000561177.1.58698 WP_000561177.1.58724 WP_000561177.1.58729 WP_000561177.1.58744 WP_000561177.1.58745 WP_000561177.1.5875 WP_000561177.1.5878 WP_000561177.1.58796 WP_000561177.1.58803 WP_000561177.1.58807 WP_000561177.1.58831 WP_000561177.1.58834 WP_000561177.1.58836 WP_000561177.1.58847 WP_000561177.1.5886 WP_000561177.1.58861 WP_000561177.1.58883 WP_000561177.1.58884 WP_000561177.1.58898 WP_000561177.1.58926 WP_000561177.1.58949 WP_000561177.1.58963 WP_000561177.1.58970 WP_000561177.1.58974 WP_000561177.1.59006 WP_000561177.1.59012 WP_000561177.1.59020 WP_000561177.1.59043 WP_000561177.1.59056 WP_000561177.1.59061 WP_000561177.1.59064 WP_000561177.1.59084 WP_000561177.1.59094 WP_000561177.1.59097 WP_000561177.1.59125 WP_000561177.1.59136 WP_000561177.1.59142 WP_000561177.1.59148 WP_000561177.1.59163 WP_000561177.1.59224 WP_000561177.1.59236 WP_000561177.1.59282 WP_000561177.1.5929 WP_000561177.1.59294 WP_000561177.1.59295 WP_000561177.1.59299 WP_000561177.1.59313 WP_000561177.1.59321 WP_000561177.1.59336 WP_000561177.1.59375 WP_000561177.1.59381 WP_000561177.1.59420 WP_000561177.1.59427 WP_000561177.1.59439 WP_000561177.1.59458 WP_000561177.1.59486 WP_000561177.1.5949 WP_000561177.1.59490 WP_000561177.1.59501 WP_000561177.1.59508 WP_000561177.1.59510 WP_000561177.1.59512 WP_000561177.1.5953 WP_000561177.1.59538 WP_000561177.1.59548 WP_000561177.1.59562 WP_000561177.1.59587 WP_000561177.1.59604 WP_000561177.1.59636 WP_000561177.1.59641 WP_000561177.1.59646 WP_000561177.1.59648 WP_000561177.1.59684 WP_000561177.1.5969 WP_000561177.1.59694 WP_000561177.1.59709 WP_000561177.1.59751 WP_000561177.1.59755 WP_000561177.1.59771 WP_000561177.1.5979 WP_000561177.1.59827 WP_000561177.1.59829 WP_000561177.1.59830 WP_000561177.1.59847 WP_000561177.1.59848 WP_000561177.1.59863 WP_000561177.1.59928 WP_000561177.1.59953 WP_000561177.1.59969 WP_000561177.1.59979 WP_000561177.1.59994 WP_000561177.1.60008 WP_000561177.1.60015 WP_000561177.1.60021 WP_000561177.1.60045 WP_000561177.1.60052 WP_000561177.1.60069 WP_000561177.1.60076 WP_000561177.1.60114 WP_000561177.1.60126 WP_000561177.1.60137 WP_000561177.1.60140 WP_000561177.1.60154 WP_000561177.1.60155 WP_000561177.1.60168 WP_000561177.1.60192 WP_000561177.1.60199 WP_000561177.1.60209 WP_000561177.1.60212 WP_000561177.1.60213 WP_000561177.1.60226 WP_000561177.1.60231 WP_000561177.1.60253 WP_000561177.1.60285 WP_000561177.1.60320 WP_000561177.1.60322 WP_000561177.1.60324 WP_000561177.1.6033 WP_000561177.1.60330 WP_000561177.1.60356 WP_000561177.1.60370 WP_000561177.1.60379 WP_000561177.1.6038 WP_000561177.1.60380 WP_000561177.1.6041 WP_000561177.1.60424 WP_000561177.1.60425 WP_000561177.1.60464 WP_000561177.1.60469 WP_000561177.1.60481 WP_000561177.1.60486 WP_000561177.1.605 WP_000561177.1.60503 WP_000561177.1.60507 WP_000561177.1.6052 WP_000561177.1.60545 WP_000561177.1.60560 WP_000561177.1.60561 WP_000561177.1.6058 WP_000561177.1.60584 WP_000561177.1.60597 WP_000561177.1.6060 WP_000561177.1.60608 WP_000561177.1.60622 WP_000561177.1.60643 WP_000561177.1.60661 WP_000561177.1.60676 WP_000561177.1.60708 WP_000561177.1.60713 WP_000561177.1.60725 WP_000561177.1.60746 WP_000561177.1.60760 WP_000561177.1.60772 WP_000561177.1.60783 WP_000561177.1.60792 WP_000561177.1.60794 WP_000561177.1.608 WP_000561177.1.60807 WP_000561177.1.60838 WP_000561177.1.60851 WP_000561177.1.60855 WP_000561177.1.60857 WP_000561177.1.60863 WP_000561177.1.60866 WP_000561177.1.60874 WP_000561177.1.60882 WP_000561177.1.60889 WP_000561177.1.60897 WP_000561177.1.6090 WP_000561177.1.60918 WP_000561177.1.60919 WP_000561177.1.60926 WP_000561177.1.60941 WP_000561177.1.60950 WP_000561177.1.60990 WP_000561177.1.6104 WP_000561177.1.61044 WP_000561177.1.61076 WP_000561177.1.61078 WP_000561177.1.6108 WP_000561177.1.61087 WP_000561177.1.61114 WP_000561177.1.61123 WP_000561177.1.6114 WP_000561177.1.61146 WP_000561177.1.61147 WP_000561177.1.61168 WP_000561177.1.61184 WP_000561177.1.61200 WP_000561177.1.61201 WP_000561177.1.61210 WP_000561177.1.61218 WP_000561177.1.61232 WP_000561177.1.61233 WP_000561177.1.6129 WP_000561177.1.61296 WP_000561177.1.61345 WP_000561177.1.61356 WP_000561177.1.61357 WP_000561177.1.61381 WP_000561177.1.61417 WP_000561177.1.61434 WP_000561177.1.61501 WP_000561177.1.61509 WP_000561177.1.61511 WP_000561177.1.61519 WP_000561177.1.61539 WP_000561177.1.61542 WP_000561177.1.61553 WP_000561177.1.61594 WP_000561177.1.61595 WP_000561177.1.61609 WP_000561177.1.6164 WP_000561177.1.61649 WP_000561177.1.61652 WP_000561177.1.61662 WP_000561177.1.61667 WP_000561177.1.61671 WP_000561177.1.61697 WP_000561177.1.61712 WP_000561177.1.61714 WP_000561177.1.61730 WP_000561177.1.61732 WP_000561177.1.61737 WP_000561177.1.61783 WP_000561177.1.61809 WP_000561177.1.61857 WP_000561177.1.61877 WP_000561177.1.6190 WP_000561177.1.61908 WP_000561177.1.61918 WP_000561177.1.61920 WP_000561177.1.61922 WP_000561177.1.61924 WP_000561177.1.61952 WP_000561177.1.62007 WP_000561177.1.62020 WP_000561177.1.62025 WP_000561177.1.62076 WP_000561177.1.6209 WP_000561177.1.6210 WP_000561177.1.62108 WP_000561177.1.62124 WP_000561177.1.62142 WP_000561177.1.62144 WP_000561177.1.62158 WP_000561177.1.62184 WP_000561177.1.62199 WP_000561177.1.62201 WP_000561177.1.62204 WP_000561177.1.62210 WP_000561177.1.62219 WP_000561177.1.62222 WP_000561177.1.62223 WP_000561177.1.62241 WP_000561177.1.62257 WP_000561177.1.62271 WP_000561177.1.62302 WP_000561177.1.62304 WP_000561177.1.62310 WP_000561177.1.62314 WP_000561177.1.62323 WP_000561177.1.62333 WP_000561177.1.62338 WP_000561177.1.62339 WP_000561177.1.62344 WP_000561177.1.62361 WP_000561177.1.62364 WP_000561177.1.62374 WP_000561177.1.62380 WP_000561177.1.62403 WP_000561177.1.62404 WP_000561177.1.62411 WP_000561177.1.62412 WP_000561177.1.62436 WP_000561177.1.62442 WP_000561177.1.62475 WP_000561177.1.62486 WP_000561177.1.62488 WP_000561177.1.62504 WP_000561177.1.6253 WP_000561177.1.62536 WP_000561177.1.62564 WP_000561177.1.62570 WP_000561177.1.62619 WP_000561177.1.62640 WP_000561177.1.62677 WP_000561177.1.62686 WP_000561177.1.62693 WP_000561177.1.627 WP_000561177.1.62725 WP_000561177.1.62745 WP_000561177.1.62751 WP_000561177.1.62757 WP_000561177.1.62798 WP_000561177.1.62825 WP_000561177.1.62828 WP_000561177.1.62853 WP_000561177.1.62903 WP_000561177.1.62910 WP_000561177.1.62913 WP_000561177.1.6292 WP_000561177.1.62932 WP_000561177.1.62955 WP_000561177.1.62960 WP_000561177.1.62983 WP_000561177.1.62988 WP_000561177.1.63016 WP_000561177.1.63025 WP_000561177.1.63043 WP_000561177.1.63045 WP_000561177.1.63063 WP_000561177.1.63069 WP_000561177.1.63087 WP_000561177.1.63102 WP_000561177.1.63118 WP_000561177.1.63135 WP_000561177.1.63150 WP_000561177.1.63155 WP_000561177.1.63169 WP_000561177.1.63186 WP_000561177.1.63203 WP_000561177.1.63229 WP_000561177.1.63234 WP_000561177.1.63243 WP_000561177.1.63250 WP_000561177.1.63256 WP_000561177.1.63290 WP_000561177.1.63297 WP_000561177.1.63382 WP_000561177.1.63432 WP_000561177.1.63448 WP_000561177.1.63461 WP_000561177.1.63479 WP_000561177.1.63497 WP_000561177.1.63509 WP_000561177.1.63513 WP_000561177.1.63514 WP_000561177.1.63525 WP_000561177.1.63529 WP_000561177.1.63532 WP_000561177.1.63568 WP_000561177.1.63577 WP_000561177.1.63583 WP_000561177.1.63585 WP_000561177.1.63592 WP_000561177.1.63603 WP_000561177.1.63633 WP_000561177.1.63663 WP_000561177.1.63664 WP_000561177.1.6367 WP_000561177.1.63677 WP_000561177.1.63690 WP_000561177.1.6370 WP_000561177.1.63718 WP_000561177.1.63731 WP_000561177.1.63736 WP_000561177.1.63748 WP_000561177.1.6375 WP_000561177.1.63766 WP_000561177.1.63782 WP_000561177.1.63797 WP_000561177.1.63816 WP_000561177.1.63824 WP_000561177.1.63831 WP_000561177.1.63834 WP_000561177.1.6384 WP_000561177.1.63851 WP_000561177.1.63860 WP_000561177.1.63863 WP_000561177.1.63864 WP_000561177.1.63866 WP_000561177.1.63876 WP_000561177.1.6389 WP_000561177.1.63901 WP_000561177.1.63903 WP_000561177.1.63912 WP_000561177.1.63934 WP_000561177.1.63955 WP_000561177.1.63958 WP_000561177.1.63963 WP_000561177.1.63977 WP_000561177.1.63992 WP_000561177.1.64007 WP_000561177.1.64010 WP_000561177.1.64018 WP_000561177.1.64032 WP_000561177.1.64046 WP_000561177.1.64072 WP_000561177.1.64085 WP_000561177.1.64087 WP_000561177.1.64109 WP_000561177.1.6415 WP_000561177.1.64157 WP_000561177.1.64176 WP_000561177.1.64208 WP_000561177.1.64229 WP_000561177.1.6423 WP_000561177.1.64242 WP_000561177.1.64244 WP_000561177.1.64266 WP_000561177.1.64293 WP_000561177.1.64294 WP_000561177.1.64332 WP_000561177.1.64350 WP_000561177.1.6437 WP_000561177.1.64374 WP_000561177.1.64376 WP_000561177.1.64385 WP_000561177.1.64387 WP_000561177.1.64389 WP_000561177.1.644 WP_000561177.1.64403 WP_000561177.1.64462 WP_000561177.1.64471 WP_000561177.1.64500 WP_000561177.1.64501 WP_000561177.1.6451 WP_000561177.1.64538 WP_000561177.1.64569 WP_000561177.1.64597 WP_000561177.1.64632 WP_000561177.1.64645 WP_000561177.1.64648 WP_000561177.1.64649 WP_000561177.1.64654 WP_000561177.1.64662 WP_000561177.1.64663 WP_000561177.1.64667 WP_000561177.1.64674 WP_000561177.1.64690 WP_000561177.1.64702 WP_000561177.1.64709 WP_000561177.1.64710 WP_000561177.1.64711 WP_000561177.1.64744 WP_000561177.1.64757 WP_000561177.1.64763 WP_000561177.1.64781 WP_000561177.1.64798 WP_000561177.1.64817 WP_000561177.1.64831 WP_000561177.1.64847 WP_000561177.1.6487 WP_000561177.1.6489 WP_000561177.1.64891 WP_000561177.1.64894 WP_000561177.1.64919 WP_000561177.1.64920 WP_000561177.1.64944 WP_000561177.1.64972 WP_000561177.1.64974 WP_000561177.1.64977 WP_000561177.1.65011 WP_000561177.1.65016 WP_000561177.1.65018 WP_000561177.1.65022 WP_000561177.1.65027 WP_000561177.1.65028 WP_000561177.1.65054 WP_000561177.1.65075 WP_000561177.1.6514 WP_000561177.1.65163 WP_000561177.1.65168 WP_000561177.1.65171 WP_000561177.1.65172 WP_000561177.1.65185 WP_000561177.1.65191 WP_000561177.1.65200 WP_000561177.1.65211 WP_000561177.1.65218 WP_000561177.1.65226 WP_000561177.1.65238 WP_000561177.1.65248 WP_000561177.1.65249 WP_000561177.1.6525 WP_000561177.1.65266 WP_000561177.1.65269 WP_000561177.1.65295 WP_000561177.1.6535 WP_000561177.1.65357 WP_000561177.1.65363 WP_000561177.1.65394 WP_000561177.1.65395 WP_000561177.1.65459 WP_000561177.1.65463 WP_000561177.1.65471 WP_000561177.1.65474 WP_000561177.1.65487 WP_000561177.1.6549 WP_000561177.1.65499 WP_000561177.1.6550 WP_000561177.1.65508 WP_000561177.1.65538 WP_000561177.1.6554 WP_000561177.1.65558 WP_000561177.1.65572 WP_000561177.1.6560 WP_000561177.1.65601 WP_000561177.1.6561 WP_000561177.1.65633 WP_000561177.1.6565 WP_000561177.1.65650 WP_000561177.1.65687 WP_000561177.1.65696 WP_000561177.1.65697 WP_000561177.1.65698 WP_000561177.1.65699 WP_000561177.1.6572 WP_000561177.1.65737 WP_000561177.1.6575 WP_000561177.1.65755 WP_000561177.1.65771 WP_000561177.1.65782 WP_000561177.1.65790 WP_000561177.1.65795 WP_000561177.1.65812 WP_000561177.1.65838 WP_000561177.1.65846 WP_000561177.1.65849 WP_000561177.1.65863 WP_000561177.1.65876 WP_000561177.1.65881 WP_000561177.1.65883 WP_000561177.1.65901 WP_000561177.1.65940 WP_000561177.1.6595 WP_000561177.1.65956 WP_000561177.1.65968 WP_000561177.1.65985 WP_000561177.1.66021 WP_000561177.1.66031 WP_000561177.1.66049 WP_000561177.1.66052 WP_000561177.1.66064 WP_000561177.1.66074 WP_000561177.1.66082 WP_000561177.1.66085 WP_000561177.1.66109 WP_000561177.1.66129 WP_000561177.1.66145 WP_000561177.1.66167 WP_000561177.1.66171 WP_000561177.1.66183 WP_000561177.1.6620 WP_000561177.1.66216 WP_000561177.1.66234 WP_000561177.1.66235 WP_000561177.1.66250 WP_000561177.1.66270 WP_000561177.1.66272 WP_000561177.1.66273 WP_000561177.1.6630 WP_000561177.1.66314 WP_000561177.1.66315 WP_000561177.1.66324 WP_000561177.1.66330 WP_000561177.1.6634 WP_000561177.1.66361 WP_000561177.1.66362 WP_000561177.1.66365 WP_000561177.1.6638 WP_000561177.1.66385 WP_000561177.1.6640 WP_000561177.1.66400 WP_000561177.1.66428 WP_000561177.1.66446 WP_000561177.1.66462 WP_000561177.1.66480 WP_000561177.1.66492 WP_000561177.1.66506 WP_000561177.1.66534 WP_000561177.1.66539 WP_000561177.1.66600 WP_000561177.1.66630 WP_000561177.1.66665 WP_000561177.1.66678 WP_000561177.1.66681 WP_000561177.1.66684 WP_000561177.1.66698 WP_000561177.1.66702 WP_000561177.1.66733 WP_000561177.1.66755 WP_000561177.1.66759 WP_000561177.1.6680 WP_000561177.1.66800 WP_000561177.1.66801 WP_000561177.1.66807 WP_000561177.1.66820 WP_000561177.1.66824 WP_000561177.1.66834 WP_000561177.1.66860 WP_000561177.1.66876 WP_000561177.1.66901 WP_000561177.1.66953 WP_000561177.1.66955 WP_000561177.1.66959 WP_000561177.1.66962 WP_000561177.1.66981 WP_000561177.1.67 WP_000561177.1.67024 WP_000561177.1.67037 WP_000561177.1.67042 WP_000561177.1.67045 WP_000561177.1.67075 WP_000561177.1.6710 WP_000561177.1.67100 WP_000561177.1.67101 WP_000561177.1.67143 WP_000561177.1.67173 WP_000561177.1.67175 WP_000561177.1.67181 WP_000561177.1.67184 WP_000561177.1.67201 WP_000561177.1.67211 WP_000561177.1.67235 WP_000561177.1.67237 WP_000561177.1.67268 WP_000561177.1.67279 WP_000561177.1.67288 WP_000561177.1.67336 WP_000561177.1.67339 WP_000561177.1.67347 WP_000561177.1.67374 WP_000561177.1.67387 WP_000561177.1.6739 WP_000561177.1.67394 WP_000561177.1.67397 WP_000561177.1.67403 WP_000561177.1.67405 WP_000561177.1.67424 WP_000561177.1.67430 WP_000561177.1.67442 WP_000561177.1.67465 WP_000561177.1.67539 WP_000561177.1.67552 WP_000561177.1.67556 WP_000561177.1.67576 WP_000561177.1.6760 WP_000561177.1.67603 WP_000561177.1.67604 WP_000561177.1.67619 WP_000561177.1.67625 WP_000561177.1.67627 WP_000561177.1.67637 WP_000561177.1.67641 WP_000561177.1.67657 WP_000561177.1.67673 WP_000561177.1.67682 WP_000561177.1.67700 WP_000561177.1.67707 WP_000561177.1.67718 WP_000561177.1.67729 WP_000561177.1.67731 WP_000561177.1.67772 WP_000561177.1.67774 WP_000561177.1.67776 WP_000561177.1.67803 WP_000561177.1.67814 WP_000561177.1.6782 WP_000561177.1.67820 WP_000561177.1.67827 WP_000561177.1.67829 WP_000561177.1.6785 WP_000561177.1.67887 WP_000561177.1.67905 WP_000561177.1.67910 WP_000561177.1.67924 WP_000561177.1.67932 WP_000561177.1.67942 WP_000561177.1.67954 WP_000561177.1.67969 WP_000561177.1.67970 WP_000561177.1.67977 WP_000561177.1.67988 WP_000561177.1.68 WP_000561177.1.68036 WP_000561177.1.68043 WP_000561177.1.68073 WP_000561177.1.68075 WP_000561177.1.6809 WP_000561177.1.68105 WP_000561177.1.68113 WP_000561177.1.68115 WP_000561177.1.68131 WP_000561177.1.68140 WP_000561177.1.68159 WP_000561177.1.68167 WP_000561177.1.68182 WP_000561177.1.6819 WP_000561177.1.68201 WP_000561177.1.68206 WP_000561177.1.68210 WP_000561177.1.6827 WP_000561177.1.68275 WP_000561177.1.68285 WP_000561177.1.6833 WP_000561177.1.68359 WP_000561177.1.68401 WP_000561177.1.68420 WP_000561177.1.68477 WP_000561177.1.68478 WP_000561177.1.6849 WP_000561177.1.68514 WP_000561177.1.68532 WP_000561177.1.68547 WP_000561177.1.68564 WP_000561177.1.6857 WP_000561177.1.6858 WP_000561177.1.68589 WP_000561177.1.68591 WP_000561177.1.68629 WP_000561177.1.68652 WP_000561177.1.68655 WP_000561177.1.68656 WP_000561177.1.68658 WP_000561177.1.68677 WP_000561177.1.68688 WP_000561177.1.6869 WP_000561177.1.68690 WP_000561177.1.68742 WP_000561177.1.6875 WP_000561177.1.68770 WP_000561177.1.68778 WP_000561177.1.68787 WP_000561177.1.6879 WP_000561177.1.68809 WP_000561177.1.68818 WP_000561177.1.6882 WP_000561177.1.6883 WP_000561177.1.68893 WP_000561177.1.68894 WP_000561177.1.68895 WP_000561177.1.68914 WP_000561177.1.68928 WP_000561177.1.68958 WP_000561177.1.68966 WP_000561177.1.68975 WP_000561177.1.68999 WP_000561177.1.69001 WP_000561177.1.69006 WP_000561177.1.69011 WP_000561177.1.69029 WP_000561177.1.6904 WP_000561177.1.69042 WP_000561177.1.6905 WP_000561177.1.69053 WP_000561177.1.69058 WP_000561177.1.69080 WP_000561177.1.69086 WP_000561177.1.6913 WP_000561177.1.69131 WP_000561177.1.69139 WP_000561177.1.69146 WP_000561177.1.69151 WP_000561177.1.69170 WP_000561177.1.69210 WP_000561177.1.69236 WP_000561177.1.69255 WP_000561177.1.69270 WP_000561177.1.69273 WP_000561177.1.69282 WP_000561177.1.69288 WP_000561177.1.69296 WP_000561177.1.69320 WP_000561177.1.69346 WP_000561177.1.69357 WP_000561177.1.69359 WP_000561177.1.69371 WP_000561177.1.69376 WP_000561177.1.69396 WP_000561177.1.69397 WP_000561177.1.69465 WP_000561177.1.69466 WP_000561177.1.69485 WP_000561177.1.69515 WP_000561177.1.6954 WP_000561177.1.69554 WP_000561177.1.69564 WP_000561177.1.69575 WP_000561177.1.69588 WP_000561177.1.69592 WP_000561177.1.69597 WP_000561177.1.69611 WP_000561177.1.69616 WP_000561177.1.69636 WP_000561177.1.69642 WP_000561177.1.69644 WP_000561177.1.69656 WP_000561177.1.69657 WP_000561177.1.69690 WP_000561177.1.69696 WP_000561177.1.69704 WP_000561177.1.69754 WP_000561177.1.69758 WP_000561177.1.69767 WP_000561177.1.69785 WP_000561177.1.69787 WP_000561177.1.69790 WP_000561177.1.69807 WP_000561177.1.69808 WP_000561177.1.69817 WP_000561177.1.69848 WP_000561177.1.69923 WP_000561177.1.69948 WP_000561177.1.69953 WP_000561177.1.69965 WP_000561177.1.69975 WP_000561177.1.69977 WP_000561177.1.69982 WP_000561177.1.70003 WP_000561177.1.70010 WP_000561177.1.70028 WP_000561177.1.70049 WP_000561177.1.70058 WP_000561177.1.70061 WP_000561177.1.70087 WP_000561177.1.70088 WP_000561177.1.7010 WP_000561177.1.7014 WP_000561177.1.7016 WP_000561177.1.70169 WP_000561177.1.70183 WP_000561177.1.70205 WP_000561177.1.7021 WP_000561177.1.70240 WP_000561177.1.70241 WP_000561177.1.70248 WP_000561177.1.70249 WP_000561177.1.70261 WP_000561177.1.70269 WP_000561177.1.70272 WP_000561177.1.70281 WP_000561177.1.70289 WP_000561177.1.70290 WP_000561177.1.70314 WP_000561177.1.70321 WP_000561177.1.70326 WP_000561177.1.70327 WP_000561177.1.7033 WP_000561177.1.70355 WP_000561177.1.70427 WP_000561177.1.70433 WP_000561177.1.7044 WP_000561177.1.70440 WP_000561177.1.70447 WP_000561177.1.70485 WP_000561177.1.70488 WP_000561177.1.70523 WP_000561177.1.70531 WP_000561177.1.70545 WP_000561177.1.70547 WP_000561177.1.7055 WP_000561177.1.70580 WP_000561177.1.70596 WP_000561177.1.70623 WP_000561177.1.70643 WP_000561177.1.70644 WP_000561177.1.70671 WP_000561177.1.70678 WP_000561177.1.70679 WP_000561177.1.70683 WP_000561177.1.70685 WP_000561177.1.70708 WP_000561177.1.70712 WP_000561177.1.70717 WP_000561177.1.70731 WP_000561177.1.70732 WP_000561177.1.70733 WP_000561177.1.70761 WP_000561177.1.70772 WP_000561177.1.70785 WP_000561177.1.70792 WP_000561177.1.70797 WP_000561177.1.70837 WP_000561177.1.70845 WP_000561177.1.70846 WP_000561177.1.70869 WP_000561177.1.70883 WP_000561177.1.70899 WP_000561177.1.70914 WP_000561177.1.70922 WP_000561177.1.7093 WP_000561177.1.70948 WP_000561177.1.70959 WP_000561177.1.70969 WP_000561177.1.70971 WP_000561177.1.70981 WP_000561177.1.70985 WP_000561177.1.70986 WP_000561177.1.70995 WP_000561177.1.71007 WP_000561177.1.71010 WP_000561177.1.71023 WP_000561177.1.71039 WP_000561177.1.71057 WP_000561177.1.71069 WP_000561177.1.71081 WP_000561177.1.71088 WP_000561177.1.7110 WP_000561177.1.71116 WP_000561177.1.71117 WP_000561177.1.71120 WP_000561177.1.71146 WP_000561177.1.71150 WP_000561177.1.71165 WP_000561177.1.71171 WP_000561177.1.71172 WP_000561177.1.71184 WP_000561177.1.71186 WP_000561177.1.71188 WP_000561177.1.71201 WP_000561177.1.71202 WP_000561177.1.71243 WP_000561177.1.71245 WP_000561177.1.71248 WP_000561177.1.71268 WP_000561177.1.71299 WP_000561177.1.71305 WP_000561177.1.71306 WP_000561177.1.71337 WP_000561177.1.7134 WP_000561177.1.71363 WP_000561177.1.71368 WP_000561177.1.71378 WP_000561177.1.714 WP_000561177.1.71401 WP_000561177.1.71407 WP_000561177.1.71418 WP_000561177.1.7142 WP_000561177.1.71446 WP_000561177.1.71450 WP_000561177.1.71455 WP_000561177.1.71456 WP_000561177.1.71481 WP_000561177.1.71487 WP_000561177.1.71500 WP_000561177.1.71523 WP_000561177.1.71542 WP_000561177.1.71566 WP_000561177.1.71583 WP_000561177.1.71626 WP_000561177.1.71636 WP_000561177.1.71640 WP_000561177.1.71649 WP_000561177.1.71651 WP_000561177.1.71653 WP_000561177.1.71667 WP_000561177.1.71691 WP_000561177.1.71702 WP_000561177.1.71716 WP_000561177.1.7174 WP_000561177.1.71746 WP_000561177.1.71750 WP_000561177.1.71756 WP_000561177.1.71793 WP_000561177.1.71798 WP_000561177.1.71845 WP_000561177.1.71872 WP_000561177.1.71881 WP_000561177.1.71908 WP_000561177.1.71929 WP_000561177.1.71941 WP_000561177.1.71950 WP_000561177.1.71952 WP_000561177.1.71954 WP_000561177.1.71973 WP_000561177.1.71979 WP_000561177.1.71984 WP_000561177.1.71985 WP_000561177.1.720 WP_000561177.1.72003 WP_000561177.1.72065 WP_000561177.1.72068 WP_000561177.1.72073 WP_000561177.1.72100 WP_000561177.1.72105 WP_000561177.1.72107 WP_000561177.1.72119 WP_000561177.1.72188 WP_000561177.1.72190 WP_000561177.1.72203 WP_000561177.1.72221 WP_000561177.1.72226 WP_000561177.1.72234 WP_000561177.1.72243 WP_000561177.1.72269 WP_000561177.1.72277 WP_000561177.1.72281 WP_000561177.1.72300 WP_000561177.1.72307 WP_000561177.1.72325 WP_000561177.1.72339 WP_000561177.1.72350 WP_000561177.1.72351 WP_000561177.1.72372 WP_000561177.1.72376 WP_000561177.1.72382 WP_000561177.1.72383 WP_000561177.1.72399 WP_000561177.1.72403 WP_000561177.1.72412 WP_000561177.1.72438 WP_000561177.1.72461 WP_000561177.1.72527 WP_000561177.1.72532 WP_000561177.1.7255 WP_000561177.1.72594 WP_000561177.1.72602 WP_000561177.1.72629 WP_000561177.1.72631 WP_000561177.1.72638 WP_000561177.1.72642 WP_000561177.1.72667 WP_000561177.1.72671 WP_000561177.1.72674 WP_000561177.1.72689 WP_000561177.1.72716 WP_000561177.1.72718 WP_000561177.1.72724 WP_000561177.1.72728 WP_000561177.1.72789 WP_000561177.1.72793 WP_000561177.1.72827 WP_000561177.1.72828 WP_000561177.1.72843 WP_000561177.1.72850 WP_000561177.1.72865 WP_000561177.1.72871 WP_000561177.1.72872 WP_000561177.1.72887 WP_000561177.1.72892 WP_000561177.1.72894 WP_000561177.1.72896 WP_000561177.1.72897 WP_000561177.1.7295 WP_000561177.1.72969 WP_000561177.1.72975 WP_000561177.1.72987 WP_000561177.1.7304 WP_000561177.1.73052 WP_000561177.1.73062 WP_000561177.1.73068 WP_000561177.1.7311 WP_000561177.1.73114 WP_000561177.1.73125 WP_000561177.1.73144 WP_000561177.1.7315 WP_000561177.1.7316 WP_000561177.1.73164 WP_000561177.1.73177 WP_000561177.1.73180 WP_000561177.1.73200 WP_000561177.1.73258 WP_000561177.1.73270 WP_000561177.1.73285 WP_000561177.1.7332 WP_000561177.1.7333 WP_000561177.1.7334 WP_000561177.1.73352 WP_000561177.1.73362 WP_000561177.1.73377 WP_000561177.1.73379 WP_000561177.1.73389 WP_000561177.1.7341 WP_000561177.1.73425 WP_000561177.1.73461 WP_000561177.1.73481 WP_000561177.1.73488 WP_000561177.1.73504 WP_000561177.1.73512 WP_000561177.1.7353 WP_000561177.1.73535 WP_000561177.1.73544 WP_000561177.1.7356 WP_000561177.1.73561 WP_000561177.1.73581 WP_000561177.1.73598 WP_000561177.1.7361 WP_000561177.1.73617 WP_000561177.1.73648 WP_000561177.1.73667 WP_000561177.1.73669 WP_000561177.1.73701 WP_000561177.1.73708 WP_000561177.1.73753 WP_000561177.1.73758 WP_000561177.1.73768 WP_000561177.1.73794 WP_000561177.1.73804 WP_000561177.1.73831 WP_000561177.1.73847 WP_000561177.1.73849 WP_000561177.1.7386 WP_000561177.1.7387 WP_000561177.1.73924 WP_000561177.1.73926 WP_000561177.1.7394 WP_000561177.1.73945 WP_000561177.1.73948 WP_000561177.1.73956 WP_000561177.1.73965 WP_000561177.1.73999 WP_000561177.1.74024 WP_000561177.1.74029 WP_000561177.1.74030 WP_000561177.1.74038 WP_000561177.1.74040 WP_000561177.1.74043 WP_000561177.1.7405 WP_000561177.1.74058 WP_000561177.1.74070 WP_000561177.1.74077 WP_000561177.1.74089 WP_000561177.1.74117 WP_000561177.1.74135 WP_000561177.1.74163 WP_000561177.1.74174 WP_000561177.1.74181 WP_000561177.1.74191 WP_000561177.1.74207 WP_000561177.1.74214 WP_000561177.1.74228 WP_000561177.1.74241 WP_000561177.1.74248 WP_000561177.1.74285 WP_000561177.1.743 WP_000561177.1.7430 WP_000561177.1.74300 WP_000561177.1.74317 WP_000561177.1.7433 WP_000561177.1.74379 WP_000561177.1.74410 WP_000561177.1.74414 WP_000561177.1.74415 WP_000561177.1.74418 WP_000561177.1.74422 WP_000561177.1.74428 WP_000561177.1.7444 WP_000561177.1.74454 WP_000561177.1.74466 WP_000561177.1.74469 WP_000561177.1.74481 WP_000561177.1.745 WP_000561177.1.74500 WP_000561177.1.74529 WP_000561177.1.74545 WP_000561177.1.74570 WP_000561177.1.74578 WP_000561177.1.7458 WP_000561177.1.74616 WP_000561177.1.74620 WP_000561177.1.74621 WP_000561177.1.74632 WP_000561177.1.74639 WP_000561177.1.74644 WP_000561177.1.74647 WP_000561177.1.74661 WP_000561177.1.74677 WP_000561177.1.74699 WP_000561177.1.74702 WP_000561177.1.74745 WP_000561177.1.74757 WP_000561177.1.74806 WP_000561177.1.74807 WP_000561177.1.74831 WP_000561177.1.74876 WP_000561177.1.74884 WP_000561177.1.74894 WP_000561177.1.7491 WP_000561177.1.74929 WP_000561177.1.74939 WP_000561177.1.74972 WP_000561177.1.74973 WP_000561177.1.74992 WP_000561177.1.74996 WP_000561177.1.75009 WP_000561177.1.75051 WP_000561177.1.75056 WP_000561177.1.75058 WP_000561177.1.7507 WP_000561177.1.75089 WP_000561177.1.75114 WP_000561177.1.75116 WP_000561177.1.75129 WP_000561177.1.75134 WP_000561177.1.75148 WP_000561177.1.75159 WP_000561177.1.75168 WP_000561177.1.75180 WP_000561177.1.75187 WP_000561177.1.75237 WP_000561177.1.75273 WP_000561177.1.75288 WP_000561177.1.75296 WP_000561177.1.75301 WP_000561177.1.7531 WP_000561177.1.75334 WP_000561177.1.75362 WP_000561177.1.75385 WP_000561177.1.75392 WP_000561177.1.75400 WP_000561177.1.75402 WP_000561177.1.75413 WP_000561177.1.7543 WP_000561177.1.75433 WP_000561177.1.75450 WP_000561177.1.75494 WP_000561177.1.75532 WP_000561177.1.75565 WP_000561177.1.7558 WP_000561177.1.75585 WP_000561177.1.75593 WP_000561177.1.75607 WP_000561177.1.75609 WP_000561177.1.75610 WP_000561177.1.75626 WP_000561177.1.75633 WP_000561177.1.75664 WP_000561177.1.75703 WP_000561177.1.75716 WP_000561177.1.75718 WP_000561177.1.75740 WP_000561177.1.75745 WP_000561177.1.75751 WP_000561177.1.75760 WP_000561177.1.75764 WP_000561177.1.75793 WP_000561177.1.75794 WP_000561177.1.75810 WP_000561177.1.75828 WP_000561177.1.75837 WP_000561177.1.75844 WP_000561177.1.75863 WP_000561177.1.75873 WP_000561177.1.75874 WP_000561177.1.75884 WP_000561177.1.75886 WP_000561177.1.75898 WP_000561177.1.75902 WP_000561177.1.75932 WP_000561177.1.75945 WP_000561177.1.75957 WP_000561177.1.76020 WP_000561177.1.76024 WP_000561177.1.76055 WP_000561177.1.76081 WP_000561177.1.76097 WP_000561177.1.76116 WP_000561177.1.76122 WP_000561177.1.76137 WP_000561177.1.76156 WP_000561177.1.76162 WP_000561177.1.76186 WP_000561177.1.76197 WP_000561177.1.76208 WP_000561177.1.76252 WP_000561177.1.76256 WP_000561177.1.7629 WP_000561177.1.76301 WP_000561177.1.76327 WP_000561177.1.7633 WP_000561177.1.76339 WP_000561177.1.7634 WP_000561177.1.76345 WP_000561177.1.76346 WP_000561177.1.76364 WP_000561177.1.76366 WP_000561177.1.76417 WP_000561177.1.76434 WP_000561177.1.76445 WP_000561177.1.76451 WP_000561177.1.7646 WP_000561177.1.76471 WP_000561177.1.76495 WP_000561177.1.76510 WP_000561177.1.76529 WP_000561177.1.76532 WP_000561177.1.76548 WP_000561177.1.7655 WP_000561177.1.76558 WP_000561177.1.7657 WP_000561177.1.76572 WP_000561177.1.76576 WP_000561177.1.7660 WP_000561177.1.76611 WP_000561177.1.76641 WP_000561177.1.76651 WP_000561177.1.76653 WP_000561177.1.76673 WP_000561177.1.76706 WP_000561177.1.7672 WP_000561177.1.76721 WP_000561177.1.76724 WP_000561177.1.76756 WP_000561177.1.76760 WP_000561177.1.76776 WP_000561177.1.76788 WP_000561177.1.76799 WP_000561177.1.76806 WP_000561177.1.7684 WP_000561177.1.76854 WP_000561177.1.76866 WP_000561177.1.76875 WP_000561177.1.76880 WP_000561177.1.76899 WP_000561177.1.76913 WP_000561177.1.76916 WP_000561177.1.76932 WP_000561177.1.76968 WP_000561177.1.76973 WP_000561177.1.76988 WP_000561177.1.77016 WP_000561177.1.77017 WP_000561177.1.77033 WP_000561177.1.77038 WP_000561177.1.77047 WP_000561177.1.77080 WP_000561177.1.77087 WP_000561177.1.77090 WP_000561177.1.77111 WP_000561177.1.7712 WP_000561177.1.77177 WP_000561177.1.77180 WP_000561177.1.77193 WP_000561177.1.77241 WP_000561177.1.77244 WP_000561177.1.77267 WP_000561177.1.77271 WP_000561177.1.77292 WP_000561177.1.77299 WP_000561177.1.77306 WP_000561177.1.77313 WP_000561177.1.77349 WP_000561177.1.77356 WP_000561177.1.77384 WP_000561177.1.77390 WP_000561177.1.77414 WP_000561177.1.77436 WP_000561177.1.77475 WP_000561177.1.77496 WP_000561177.1.77501 WP_000561177.1.77512 WP_000561177.1.77513 WP_000561177.1.77514 WP_000561177.1.77543 WP_000561177.1.77549 WP_000561177.1.77555 WP_000561177.1.77563 WP_000561177.1.77575 WP_000561177.1.77596 WP_000561177.1.77646 WP_000561177.1.77653 WP_000561177.1.77692 WP_000561177.1.77702 WP_000561177.1.77710 WP_000561177.1.77713 WP_000561177.1.7772 WP_000561177.1.77729 WP_000561177.1.77754 WP_000561177.1.77761 WP_000561177.1.7782 WP_000561177.1.77825 WP_000561177.1.77837 WP_000561177.1.77846 WP_000561177.1.77851 WP_000561177.1.77871 WP_000561177.1.77900 WP_000561177.1.77918 WP_000561177.1.7792 WP_000561177.1.77923 WP_000561177.1.7793 WP_000561177.1.77951 WP_000561177.1.77960 WP_000561177.1.77975 WP_000561177.1.77983 WP_000561177.1.77987 WP_000561177.1.77989 WP_000561177.1.78 WP_000561177.1.78016 WP_000561177.1.7802 WP_000561177.1.78033 WP_000561177.1.78035 WP_000561177.1.78048 WP_000561177.1.78051 WP_000561177.1.78076 WP_000561177.1.78096 WP_000561177.1.78100 WP_000561177.1.78107 WP_000561177.1.78110 WP_000561177.1.78120 WP_000561177.1.7814 WP_000561177.1.78166 WP_000561177.1.78168 WP_000561177.1.78170 WP_000561177.1.78180 WP_000561177.1.78192 WP_000561177.1.78195 WP_000561177.1.78201 WP_000561177.1.78245 WP_000561177.1.78291 WP_000561177.1.78301 WP_000561177.1.78309 WP_000561177.1.78320 WP_000561177.1.78339 WP_000561177.1.78366 WP_000561177.1.78372 WP_000561177.1.78382 WP_000561177.1.78383 WP_000561177.1.78388 WP_000561177.1.78407 WP_000561177.1.78410 WP_000561177.1.78443 WP_000561177.1.78495 WP_000561177.1.78496 WP_000561177.1.78501 WP_000561177.1.78502 WP_000561177.1.78602 WP_000561177.1.78603 WP_000561177.1.7861 WP_000561177.1.78618 WP_000561177.1.7862 WP_000561177.1.78626 WP_000561177.1.78632 WP_000561177.1.78658 WP_000561177.1.78661 WP_000561177.1.78673 WP_000561177.1.78674 WP_000561177.1.78676 WP_000561177.1.78697 WP_000561177.1.78734 WP_000561177.1.78735 WP_000561177.1.78738 WP_000561177.1.78761 WP_000561177.1.7877 WP_000561177.1.78771 WP_000561177.1.78802 WP_000561177.1.78815 WP_000561177.1.78830 WP_000561177.1.78835 WP_000561177.1.78838 WP_000561177.1.78862 WP_000561177.1.78871 WP_000561177.1.78874 WP_000561177.1.78877 WP_000561177.1.78881 WP_000561177.1.78896 WP_000561177.1.789 WP_000561177.1.7891 WP_000561177.1.78913 WP_000561177.1.78918 WP_000561177.1.78928 WP_000561177.1.7893 WP_000561177.1.78930 WP_000561177.1.78951 WP_000561177.1.78993 WP_000561177.1.79011 WP_000561177.1.79012 WP_000561177.1.79032 WP_000561177.1.79069 WP_000561177.1.79074 WP_000561177.1.79098 WP_000561177.1.79099 WP_000561177.1.79151 WP_000561177.1.79155 WP_000561177.1.79164 WP_000561177.1.79167 WP_000561177.1.79189 WP_000561177.1.79203 WP_000561177.1.79204 WP_000561177.1.79235 WP_000561177.1.79280 WP_000561177.1.79289 WP_000561177.1.79302 WP_000561177.1.79335 WP_000561177.1.79397 WP_000561177.1.794 WP_000561177.1.79427 WP_000561177.1.79456 WP_000561177.1.79462 WP_000561177.1.79466 WP_000561177.1.79468 WP_000561177.1.79472 WP_000561177.1.79490 WP_000561177.1.79495 WP_000561177.1.79529 WP_000561177.1.79532 WP_000561177.1.79547 WP_000561177.1.7956 WP_000561177.1.79580 WP_000561177.1.79586 WP_000561177.1.79635 WP_000561177.1.7964 WP_000561177.1.79642 WP_000561177.1.79645 WP_000561177.1.79654 WP_000561177.1.79659 WP_000561177.1.79668 WP_000561177.1.7970 WP_000561177.1.79708 WP_000561177.1.7972 WP_000561177.1.79722 WP_000561177.1.79734 WP_000561177.1.79738 WP_000561177.1.79772 WP_000561177.1.79778 WP_000561177.1.7982 WP_000561177.1.79832 WP_000561177.1.79845 WP_000561177.1.79867 WP_000561177.1.79880 WP_000561177.1.79892 WP_000561177.1.79914 WP_000561177.1.79916 WP_000561177.1.79929 WP_000561177.1.79934 WP_000561177.1.7994 WP_000561177.1.79951 WP_000561177.1.79966 WP_000561177.1.79974 WP_000561177.1.79996 WP_000561177.1.80065 WP_000561177.1.80077 WP_000561177.1.80103 WP_000561177.1.80137 WP_000561177.1.80149 WP_000561177.1.80182 WP_000561177.1.80229 WP_000561177.1.80236 WP_000561177.1.8024 WP_000561177.1.80249 WP_000561177.1.80250 WP_000561177.1.80254 WP_000561177.1.80273 WP_000561177.1.80282 WP_000561177.1.80293 WP_000561177.1.80296 WP_000561177.1.80307 WP_000561177.1.80333 WP_000561177.1.80354 WP_000561177.1.80366 WP_000561177.1.80368 WP_000561177.1.80380 WP_000561177.1.80386 WP_000561177.1.80400 WP_000561177.1.80441 WP_000561177.1.80448 WP_000561177.1.80462 WP_000561177.1.80473 WP_000561177.1.80479 WP_000561177.1.8049 WP_000561177.1.80492 WP_000561177.1.80496 WP_000561177.1.80529 WP_000561177.1.80569 WP_000561177.1.80586 WP_000561177.1.80651 WP_000561177.1.80664 WP_000561177.1.80667 WP_000561177.1.80674 WP_000561177.1.80696 WP_000561177.1.80707 WP_000561177.1.80723 WP_000561177.1.80725 WP_000561177.1.80741 WP_000561177.1.80750 WP_000561177.1.80757 WP_000561177.1.80760 WP_000561177.1.80780 WP_000561177.1.80803 WP_000561177.1.80827 WP_000561177.1.80831 WP_000561177.1.80840 WP_000561177.1.80850 WP_000561177.1.80857 WP_000561177.1.80868 WP_000561177.1.80874 WP_000561177.1.80876 WP_000561177.1.80881 WP_000561177.1.80913 WP_000561177.1.80939 WP_000561177.1.80959 WP_000561177.1.8096 WP_000561177.1.80973 WP_000561177.1.80984 WP_000561177.1.81037 WP_000561177.1.8106 WP_000561177.1.81062 WP_000561177.1.81069 WP_000561177.1.81107 WP_000561177.1.81109 WP_000561177.1.81110 WP_000561177.1.81118 WP_000561177.1.81131 WP_000561177.1.81149 WP_000561177.1.81175 WP_000561177.1.81187 WP_000561177.1.8119 WP_000561177.1.81197 WP_000561177.1.81225 WP_000561177.1.81262 WP_000561177.1.81268 WP_000561177.1.81269 WP_000561177.1.8127 WP_000561177.1.81271 WP_000561177.1.81275 WP_000561177.1.8130 WP_000561177.1.81302 WP_000561177.1.81305 WP_000561177.1.8131 WP_000561177.1.81320 WP_000561177.1.81321 WP_000561177.1.81328 WP_000561177.1.81333 WP_000561177.1.8134 WP_000561177.1.81342 WP_000561177.1.81354 WP_000561177.1.81364 WP_000561177.1.81388 WP_000561177.1.81404 WP_000561177.1.81410 WP_000561177.1.81425 WP_000561177.1.81472 WP_000561177.1.81494 WP_000561177.1.81504 WP_000561177.1.81528 WP_000561177.1.81557 WP_000561177.1.81667 WP_000561177.1.81668 WP_000561177.1.81676 WP_000561177.1.81681 WP_000561177.1.8170 WP_000561177.1.81735 WP_000561177.1.81736 WP_000561177.1.81750 WP_000561177.1.81760 WP_000561177.1.81763 WP_000561177.1.81768 WP_000561177.1.81785 WP_000561177.1.81855 WP_000561177.1.81902 WP_000561177.1.81921 WP_000561177.1.81931 WP_000561177.1.81936 WP_000561177.1.81941 WP_000561177.1.81949 WP_000561177.1.8196 WP_000561177.1.81965 WP_000561177.1.81974 WP_000561177.1.81977 WP_000561177.1.81995 WP_000561177.1.82037 WP_000561177.1.82070 WP_000561177.1.82076 WP_000561177.1.82099 WP_000561177.1.82131 WP_000561177.1.82141 WP_000561177.1.82144 WP_000561177.1.82149 WP_000561177.1.82156 WP_000561177.1.8218 WP_000561177.1.82180 WP_000561177.1.82192 WP_000561177.1.82201 WP_000561177.1.82214 WP_000561177.1.82225 WP_000561177.1.82232 WP_000561177.1.82269 WP_000561177.1.82337 WP_000561177.1.82347 WP_000561177.1.82352 WP_000561177.1.82395 WP_000561177.1.8240 WP_000561177.1.82401 WP_000561177.1.82408 WP_000561177.1.82416 WP_000561177.1.8242 WP_000561177.1.82420 WP_000561177.1.82434 WP_000561177.1.82456 WP_000561177.1.82464 WP_000561177.1.82465 WP_000561177.1.8247 WP_000561177.1.82473 WP_000561177.1.82474 WP_000561177.1.82479 WP_000561177.1.82503 WP_000561177.1.82515 WP_000561177.1.82529 WP_000561177.1.82530 WP_000561177.1.82553 WP_000561177.1.82562 WP_000561177.1.82569 WP_000561177.1.82570 WP_000561177.1.82584 WP_000561177.1.82637 WP_000561177.1.82646 WP_000561177.1.82648 WP_000561177.1.82670 WP_000561177.1.82676 WP_000561177.1.82731 WP_000561177.1.82761 WP_000561177.1.82763 WP_000561177.1.82812 WP_000561177.1.8282 WP_000561177.1.82841 WP_000561177.1.82843 WP_000561177.1.82850 WP_000561177.1.82865 WP_000561177.1.82872 WP_000561177.1.82886 WP_000561177.1.82895 WP_000561177.1.82899 WP_000561177.1.82908 WP_000561177.1.82937 WP_000561177.1.8294 WP_000561177.1.82944 WP_000561177.1.82946 WP_000561177.1.82956 WP_000561177.1.82959 WP_000561177.1.82964 WP_000561177.1.82992 WP_000561177.1.83005 WP_000561177.1.83006 WP_000561177.1.83007 WP_000561177.1.8304 WP_000561177.1.83061 WP_000561177.1.83092 WP_000561177.1.83119 WP_000561177.1.83128 WP_000561177.1.83139 WP_000561177.1.83163 WP_000561177.1.83180 WP_000561177.1.83204 WP_000561177.1.8322 WP_000561177.1.83229 WP_000561177.1.83235 WP_000561177.1.83247 WP_000561177.1.83258 WP_000561177.1.83290 WP_000561177.1.83301 WP_000561177.1.83305 WP_000561177.1.83331 WP_000561177.1.83333 WP_000561177.1.83354 WP_000561177.1.83356 WP_000561177.1.83360 WP_000561177.1.83365 WP_000561177.1.83378 WP_000561177.1.83388 WP_000561177.1.83413 WP_000561177.1.83491 WP_000561177.1.83510 WP_000561177.1.83516 WP_000561177.1.83523 WP_000561177.1.8354 WP_000561177.1.83558 WP_000561177.1.83572 WP_000561177.1.83598 WP_000561177.1.83650 WP_000561177.1.83651 WP_000561177.1.83657 WP_000561177.1.83677 WP_000561177.1.83721 WP_000561177.1.83739 WP_000561177.1.8375 WP_000561177.1.83760 WP_000561177.1.83854 WP_000561177.1.83923 WP_000561177.1.83960 WP_000561177.1.83979 WP_000561177.1.8399 WP_000561177.1.83994 WP_000561177.1.83995 WP_000561177.1.84 WP_000561177.1.84000 WP_000561177.1.84011 WP_000561177.1.84031 WP_000561177.1.8406 WP_000561177.1.84075 WP_000561177.1.84076 WP_000561177.1.84077 WP_000561177.1.84083 WP_000561177.1.84086 WP_000561177.1.84103 WP_000561177.1.84106 WP_000561177.1.84110 WP_000561177.1.84115 WP_000561177.1.84127 WP_000561177.1.84150 WP_000561177.1.84154 WP_000561177.1.84168 WP_000561177.1.84179 WP_000561177.1.84198 WP_000561177.1.84205 WP_000561177.1.84209 WP_000561177.1.84229 WP_000561177.1.84230 WP_000561177.1.84252 WP_000561177.1.84283 WP_000561177.1.84291 WP_000561177.1.84300 WP_000561177.1.8431 WP_000561177.1.84325 WP_000561177.1.84345 WP_000561177.1.84355 WP_000561177.1.84359 WP_000561177.1.84369 WP_000561177.1.84373 WP_000561177.1.84392 WP_000561177.1.84397 WP_000561177.1.84401 WP_000561177.1.84403 WP_000561177.1.8441 WP_000561177.1.84435 WP_000561177.1.84459 WP_000561177.1.84461 WP_000561177.1.84475 WP_000561177.1.84497 WP_000561177.1.84515 WP_000561177.1.84523 WP_000561177.1.84532 WP_000561177.1.84567 WP_000561177.1.84572 WP_000561177.1.84598 WP_000561177.1.84631 WP_000561177.1.84644 WP_000561177.1.84659 WP_000561177.1.84683 WP_000561177.1.84693 WP_000561177.1.84711 WP_000561177.1.84721 WP_000561177.1.84727 WP_000561177.1.84744 WP_000561177.1.84745 WP_000561177.1.84773 WP_000561177.1.84876 WP_000561177.1.84899 WP_000561177.1.849 WP_000561177.1.84945 WP_000561177.1.84967 WP_000561177.1.8497 WP_000561177.1.84983 WP_000561177.1.850 WP_000561177.1.85004 WP_000561177.1.85014 WP_000561177.1.8502 WP_000561177.1.85031 WP_000561177.1.85039 WP_000561177.1.85040 WP_000561177.1.85079 WP_000561177.1.85120 WP_000561177.1.85134 WP_000561177.1.85147 WP_000561177.1.85153 WP_000561177.1.85178 WP_000561177.1.85180 WP_000561177.1.85190 WP_000561177.1.85192 WP_000561177.1.85217 WP_000561177.1.8526 WP_000561177.1.85271 WP_000561177.1.85273 WP_000561177.1.85301 WP_000561177.1.8533 WP_000561177.1.85338 WP_000561177.1.85339 WP_000561177.1.8537 WP_000561177.1.85408 WP_000561177.1.8545 WP_000561177.1.85456 WP_000561177.1.85469 WP_000561177.1.85481 WP_000561177.1.85483 WP_000561177.1.85511 WP_000561177.1.85512 WP_000561177.1.8552 WP_000561177.1.85541 WP_000561177.1.8556 WP_000561177.1.85568 WP_000561177.1.8557 WP_000561177.1.85606 WP_000561177.1.85615 WP_000561177.1.85617 WP_000561177.1.85635 WP_000561177.1.85646 WP_000561177.1.85654 WP_000561177.1.85663 WP_000561177.1.85665 WP_000561177.1.85669 WP_000561177.1.85671 WP_000561177.1.85672 WP_000561177.1.85675 WP_000561177.1.85688 WP_000561177.1.85703 WP_000561177.1.85723 WP_000561177.1.85728 WP_000561177.1.85742 WP_000561177.1.85746 WP_000561177.1.85759 WP_000561177.1.85777 WP_000561177.1.85780 WP_000561177.1.85784 WP_000561177.1.85797 WP_000561177.1.85811 WP_000561177.1.85854 WP_000561177.1.85855 WP_000561177.1.85886 WP_000561177.1.859 WP_000561177.1.85900 WP_000561177.1.85904 WP_000561177.1.8591 WP_000561177.1.85917 WP_000561177.1.8594 WP_000561177.1.85976 WP_000561177.1.85977 WP_000561177.1.85982 WP_000561177.1.860 WP_000561177.1.86007 WP_000561177.1.86010 WP_000561177.1.86017 WP_000561177.1.86043 WP_000561177.1.8605 WP_000561177.1.86084 WP_000561177.1.86092 WP_000561177.1.8610 WP_000561177.1.86120 WP_000561177.1.86126 WP_000561177.1.86138 WP_000561177.1.8614 WP_000561177.1.86156 WP_000561177.1.86157 WP_000561177.1.8616 WP_000561177.1.86173 WP_000561177.1.86206 WP_000561177.1.86224 WP_000561177.1.86259 WP_000561177.1.86284 WP_000561177.1.86285 WP_000561177.1.86306 WP_000561177.1.86310 WP_000561177.1.86323 WP_000561177.1.86335 WP_000561177.1.86342 WP_000561177.1.86347 WP_000561177.1.86356 WP_000561177.1.86380 WP_000561177.1.86389 WP_000561177.1.8640 WP_000561177.1.8642 WP_000561177.1.86426 WP_000561177.1.86442 WP_000561177.1.86450 WP_000561177.1.86453 WP_000561177.1.86469 WP_000561177.1.8647 WP_000561177.1.86489 WP_000561177.1.86514 WP_000561177.1.86530 WP_000561177.1.86580 WP_000561177.1.86588 WP_000561177.1.86593 WP_000561177.1.86601 WP_000561177.1.86610 WP_000561177.1.86634 WP_000561177.1.86656 WP_000561177.1.86658 WP_000561177.1.86661 WP_000561177.1.86663 WP_000561177.1.86676 WP_000561177.1.8671 WP_000561177.1.8672 WP_000561177.1.86770 WP_000561177.1.8678 WP_000561177.1.86794 WP_000561177.1.86800 WP_000561177.1.86807 WP_000561177.1.86810 WP_000561177.1.86811 WP_000561177.1.86815 WP_000561177.1.8684 WP_000561177.1.86859 WP_000561177.1.86860 WP_000561177.1.86895 WP_000561177.1.86906 WP_000561177.1.8691 WP_000561177.1.86915 WP_000561177.1.86921 WP_000561177.1.86945 WP_000561177.1.86982 WP_000561177.1.86989 WP_000561177.1.87023 WP_000561177.1.87034 WP_000561177.1.87038 WP_000561177.1.87041 WP_000561177.1.87051 WP_000561177.1.87095 WP_000561177.1.87136 WP_000561177.1.87143 WP_000561177.1.87148 WP_000561177.1.87155 WP_000561177.1.87187 WP_000561177.1.87219 WP_000561177.1.8722 WP_000561177.1.87258 WP_000561177.1.87265 WP_000561177.1.87282 WP_000561177.1.87283 WP_000561177.1.87293 WP_000561177.1.87323 WP_000561177.1.87346 WP_000561177.1.8736 WP_000561177.1.87365 WP_000561177.1.87370 WP_000561177.1.87420 WP_000561177.1.87460 WP_000561177.1.87484 WP_000561177.1.87493 WP_000561177.1.87500 WP_000561177.1.87528 WP_000561177.1.87552 WP_000561177.1.87560 WP_000561177.1.87583 WP_000561177.1.8760 WP_000561177.1.87600 WP_000561177.1.87609 WP_000561177.1.87612 WP_000561177.1.87615 WP_000561177.1.87618 WP_000561177.1.87626 WP_000561177.1.87653 WP_000561177.1.87659 WP_000561177.1.87695 WP_000561177.1.87698 WP_000561177.1.87706 WP_000561177.1.87712 WP_000561177.1.87739 WP_000561177.1.87741 WP_000561177.1.87742 WP_000561177.1.87779 WP_000561177.1.87813 WP_000561177.1.87852 WP_000561177.1.87875 WP_000561177.1.87899 WP_000561177.1.87905 WP_000561177.1.8792 WP_000561177.1.87933 WP_000561177.1.87945 WP_000561177.1.87949 WP_000561177.1.87999 WP_000561177.1.8800 WP_000561177.1.88014 WP_000561177.1.88019 WP_000561177.1.88025 WP_000561177.1.88026 WP_000561177.1.8805 WP_000561177.1.88052 WP_000561177.1.8806 WP_000561177.1.88073 WP_000561177.1.8809 WP_000561177.1.88092 WP_000561177.1.881 WP_000561177.1.88136 WP_000561177.1.88145 WP_000561177.1.88174 WP_000561177.1.88185 WP_000561177.1.88199 WP_000561177.1.88214 WP_000561177.1.88222 WP_000561177.1.88244 WP_000561177.1.88264 WP_000561177.1.88275 WP_000561177.1.88291 WP_000561177.1.88293 WP_000561177.1.88299 WP_000561177.1.88303 WP_000561177.1.88313 WP_000561177.1.88356 WP_000561177.1.88359 WP_000561177.1.8837 WP_000561177.1.88393 WP_000561177.1.88407 WP_000561177.1.88414 WP_000561177.1.88423 WP_000561177.1.88444 WP_000561177.1.88446 WP_000561177.1.88458 WP_000561177.1.88474 WP_000561177.1.88483 WP_000561177.1.8849 WP_000561177.1.88501 WP_000561177.1.88508 WP_000561177.1.88538 WP_000561177.1.88547 WP_000561177.1.88597 WP_000561177.1.886 WP_000561177.1.88609 WP_000561177.1.88624 WP_000561177.1.88647 WP_000561177.1.88648 WP_000561177.1.88651 WP_000561177.1.88675 WP_000561177.1.88683 WP_000561177.1.88692 WP_000561177.1.88698 WP_000561177.1.88703 WP_000561177.1.88707 WP_000561177.1.88727 WP_000561177.1.88731 WP_000561177.1.88772 WP_000561177.1.88776 WP_000561177.1.88792 WP_000561177.1.88845 WP_000561177.1.88850 WP_000561177.1.88854 WP_000561177.1.8889 WP_000561177.1.88892 WP_000561177.1.88894 WP_000561177.1.88902 WP_000561177.1.8891 WP_000561177.1.88942 WP_000561177.1.88957 WP_000561177.1.88966 WP_000561177.1.88967 WP_000561177.1.88968 WP_000561177.1.88970 WP_000561177.1.88980 WP_000561177.1.88981 WP_000561177.1.88995 WP_000561177.1.88998 WP_000561177.1.89008 WP_000561177.1.89054 WP_000561177.1.89114 WP_000561177.1.89116 WP_000561177.1.89119 WP_000561177.1.89120 WP_000561177.1.89138 WP_000561177.1.89169 WP_000561177.1.89177 WP_000561177.1.89182 WP_000561177.1.89188 WP_000561177.1.89215 WP_000561177.1.89221 WP_000561177.1.89291 WP_000561177.1.89298 WP_000561177.1.89304 WP_000561177.1.89308 WP_000561177.1.89311 WP_000561177.1.89314 WP_000561177.1.89328 WP_000561177.1.89332 WP_000561177.1.89343 WP_000561177.1.89354 WP_000561177.1.89355 WP_000561177.1.89362 WP_000561177.1.89395 WP_000561177.1.8940 WP_000561177.1.89408 WP_000561177.1.89425 WP_000561177.1.89449 WP_000561177.1.89452 WP_000561177.1.8947 WP_000561177.1.89503 WP_000561177.1.89512 WP_000561177.1.89527 WP_000561177.1.89570 WP_000561177.1.8958 WP_000561177.1.89580 WP_000561177.1.89591 WP_000561177.1.89604 WP_000561177.1.89606 WP_000561177.1.8961 WP_000561177.1.89612 WP_000561177.1.89622 WP_000561177.1.89632 WP_000561177.1.89634 WP_000561177.1.89636 WP_000561177.1.89657 WP_000561177.1.89659 WP_000561177.1.89668 WP_000561177.1.89680 WP_000561177.1.89706 WP_000561177.1.89713 WP_000561177.1.89733 WP_000561177.1.89746 WP_000561177.1.89765 WP_000561177.1.89789 WP_000561177.1.89796 WP_000561177.1.89804 WP_000561177.1.89815 WP_000561177.1.89817 WP_000561177.1.89832 WP_000561177.1.89845 WP_000561177.1.89854 WP_000561177.1.89870 WP_000561177.1.89888 WP_000561177.1.89902 WP_000561177.1.89911 WP_000561177.1.89914 WP_000561177.1.89940 WP_000561177.1.8995 WP_000561177.1.89952 WP_000561177.1.8996 WP_000561177.1.89965 WP_000561177.1.89975 WP_000561177.1.90007 WP_000561177.1.9002 WP_000561177.1.9003 WP_000561177.1.90033 WP_000561177.1.90084 WP_000561177.1.90097 WP_000561177.1.9011 WP_000561177.1.90193 WP_000561177.1.90196 WP_000561177.1.90211 WP_000561177.1.90220 WP_000561177.1.90240 WP_000561177.1.90252 WP_000561177.1.90274 WP_000561177.1.90280 WP_000561177.1.90293 WP_000561177.1.90330 WP_000561177.1.90338 WP_000561177.1.90363 WP_000561177.1.90365 WP_000561177.1.90417 WP_000561177.1.90421 WP_000561177.1.90428 WP_000561177.1.90440 WP_000561177.1.90453 WP_000561177.1.90458 WP_000561177.1.90472 WP_000561177.1.90489 WP_000561177.1.90513 WP_000561177.1.90521 WP_000561177.1.90522 WP_000561177.1.90540 WP_000561177.1.90557 WP_000561177.1.90563 WP_000561177.1.90566 WP_000561177.1.90582 WP_000561177.1.90585 WP_000561177.1.90620 WP_000561177.1.90625 WP_000561177.1.9064 WP_000561177.1.90641 WP_000561177.1.90686 WP_000561177.1.90713 WP_000561177.1.90734 WP_000561177.1.90748 WP_000561177.1.90759 WP_000561177.1.90794 WP_000561177.1.90796 WP_000561177.1.90811 WP_000561177.1.90814 WP_000561177.1.90859 WP_000561177.1.90878 WP_000561177.1.9089 WP_000561177.1.9091 WP_000561177.1.9093 WP_000561177.1.90959 WP_000561177.1.90973 WP_000561177.1.90984 WP_000561177.1.90991 WP_000561177.1.91003 WP_000561177.1.91023 WP_000561177.1.91042 WP_000561177.1.91049 WP_000561177.1.91056 WP_000561177.1.91067 WP_000561177.1.91069 WP_000561177.1.91107 WP_000561177.1.91156 WP_000561177.1.91164 WP_000561177.1.91179 WP_000561177.1.91189 WP_000561177.1.91205 WP_000561177.1.91215 WP_000561177.1.91239 WP_000561177.1.91278 WP_000561177.1.91291 WP_000561177.1.9131 WP_000561177.1.91313 WP_000561177.1.91334 WP_000561177.1.9135 WP_000561177.1.9137 WP_000561177.1.91372 WP_000561177.1.91405 WP_000561177.1.91424 WP_000561177.1.91459 WP_000561177.1.91470 WP_000561177.1.91473 WP_000561177.1.91474 WP_000561177.1.91505 WP_000561177.1.91506 WP_000561177.1.91512 WP_000561177.1.91524 WP_000561177.1.91528 WP_000561177.1.91557 WP_000561177.1.91564 WP_000561177.1.91579 WP_000561177.1.91580 WP_000561177.1.91597 WP_000561177.1.91621 WP_000561177.1.91625 WP_000561177.1.91628 WP_000561177.1.91702 WP_000561177.1.91715 WP_000561177.1.91724 WP_000561177.1.91732 WP_000561177.1.91736 WP_000561177.1.91742 WP_000561177.1.91772 WP_000561177.1.91776 WP_000561177.1.91788 WP_000561177.1.91795 WP_000561177.1.91806 WP_000561177.1.91864 WP_000561177.1.9187 WP_000561177.1.91870 WP_000561177.1.91880 WP_000561177.1.91898 WP_000561177.1.91903 WP_000561177.1.91904 WP_000561177.1.91914 WP_000561177.1.91974 WP_000561177.1.92013 WP_000561177.1.92018 WP_000561177.1.92039 WP_000561177.1.92044 WP_000561177.1.92047 WP_000561177.1.92060 WP_000561177.1.92067 WP_000561177.1.92068 WP_000561177.1.92082 WP_000561177.1.92087 WP_000561177.1.92093 WP_000561177.1.92098 WP_000561177.1.92099 WP_000561177.1.92108 WP_000561177.1.92122 WP_000561177.1.92129 WP_000561177.1.92149 WP_000561177.1.92156 WP_000561177.1.92165 WP_000561177.1.92171 WP_000561177.1.92172 WP_000561177.1.92183 WP_000561177.1.92208 WP_000561177.1.92213 WP_000561177.1.9222 WP_000561177.1.92240 WP_000561177.1.92243 WP_000561177.1.92268 WP_000561177.1.92270 WP_000561177.1.92299 WP_000561177.1.92310 WP_000561177.1.92318 WP_000561177.1.92327 WP_000561177.1.92375 WP_000561177.1.92394 WP_000561177.1.92396 WP_000561177.1.92399 WP_000561177.1.92408 WP_000561177.1.92411 WP_000561177.1.92439 WP_000561177.1.92443 WP_000561177.1.92452 WP_000561177.1.92470 WP_000561177.1.92477 WP_000561177.1.92482 WP_000561177.1.92529 WP_000561177.1.9253 WP_000561177.1.92531 WP_000561177.1.92545 WP_000561177.1.92557 WP_000561177.1.92562 WP_000561177.1.92570 WP_000561177.1.92575 WP_000561177.1.92588 WP_000561177.1.926 WP_000561177.1.92628 WP_000561177.1.92633 WP_000561177.1.92649 WP_000561177.1.92669 WP_000561177.1.92671 WP_000561177.1.92676 WP_000561177.1.92705 WP_000561177.1.9271 WP_000561177.1.92729 WP_000561177.1.92734 WP_000561177.1.92738 WP_000561177.1.92758 WP_000561177.1.92806 WP_000561177.1.92810 WP_000561177.1.92823 WP_000561177.1.92827 WP_000561177.1.92832 WP_000561177.1.92836 WP_000561177.1.92843 WP_000561177.1.92875 WP_000561177.1.92879 WP_000561177.1.92883 WP_000561177.1.92890 WP_000561177.1.92893 WP_000561177.1.92895 WP_000561177.1.92929 WP_000561177.1.92939 WP_000561177.1.92947 WP_000561177.1.92975 WP_000561177.1.92987 WP_000561177.1.92988 WP_000561177.1.93007 WP_000561177.1.93022 WP_000561177.1.93059 WP_000561177.1.93076 WP_000561177.1.93086 WP_000561177.1.93101 WP_000561177.1.93103 WP_000561177.1.93105 WP_000561177.1.93111 WP_000561177.1.93121 WP_000561177.1.93136 WP_000561177.1.93155 WP_000561177.1.93168 WP_000561177.1.93184 WP_000561177.1.93213 WP_000561177.1.93215 WP_000561177.1.93221 WP_000561177.1.93223 WP_000561177.1.93239 WP_000561177.1.93275 WP_000561177.1.93302 WP_000561177.1.93322 WP_000561177.1.93339 WP_000561177.1.93350 WP_000561177.1.9336 WP_000561177.1.93365 WP_000561177.1.93376 WP_000561177.1.93387 WP_000561177.1.93469 WP_000561177.1.93511 WP_000561177.1.93512 WP_000561177.1.93524 WP_000561177.1.93543 WP_000561177.1.93577 WP_000561177.1.93596 WP_000561177.1.93635 WP_000561177.1.93648 WP_000561177.1.93650 WP_000561177.1.93656 WP_000561177.1.93657 WP_000561177.1.93662 WP_000561177.1.93691 WP_000561177.1.937 WP_000561177.1.93705 WP_000561177.1.9374 WP_000561177.1.93741 WP_000561177.1.9375 WP_000561177.1.93754 WP_000561177.1.93767 WP_000561177.1.93780 WP_000561177.1.9380 WP_000561177.1.93803 WP_000561177.1.93804 WP_000561177.1.93809 WP_000561177.1.93828 WP_000561177.1.93842 WP_000561177.1.93843 WP_000561177.1.93875 WP_000561177.1.9389 WP_000561177.1.93909 WP_000561177.1.93919 WP_000561177.1.93937 WP_000561177.1.93938 WP_000561177.1.9394 WP_000561177.1.93956 WP_000561177.1.93984 WP_000561177.1.93986 WP_000561177.1.9399 WP_000561177.1.93994 WP_000561177.1.94017 WP_000561177.1.94039 WP_000561177.1.94056 WP_000561177.1.94064 WP_000561177.1.94072 WP_000561177.1.94079 WP_000561177.1.94097 WP_000561177.1.94107 WP_000561177.1.94132 WP_000561177.1.94142 WP_000561177.1.94162 WP_000561177.1.94167 WP_000561177.1.94168 WP_000561177.1.94181 WP_000561177.1.94198 WP_000561177.1.94215 WP_000561177.1.94303 WP_000561177.1.9432 WP_000561177.1.94352 WP_000561177.1.94354 WP_000561177.1.94365 WP_000561177.1.94379 WP_000561177.1.94380 WP_000561177.1.94390 WP_000561177.1.9440 WP_000561177.1.94415 WP_000561177.1.94458 WP_000561177.1.94473 WP_000561177.1.94492 WP_000561177.1.94510 WP_000561177.1.94527 WP_000561177.1.94557 WP_000561177.1.94562 WP_000561177.1.94565 WP_000561177.1.94573 WP_000561177.1.94579 WP_000561177.1.94584 WP_000561177.1.94586 WP_000561177.1.94588 WP_000561177.1.94593 WP_000561177.1.94598 WP_000561177.1.94622 WP_000561177.1.9463 WP_000561177.1.94649 WP_000561177.1.94650 WP_000561177.1.94655 WP_000561177.1.94659 WP_000561177.1.94662 WP_000561177.1.94669 WP_000561177.1.94670 WP_000561177.1.94674 WP_000561177.1.94700 WP_000561177.1.94717 WP_000561177.1.94722 WP_000561177.1.94745 WP_000561177.1.94782 WP_000561177.1.94785 WP_000561177.1.94796 WP_000561177.1.94798 WP_000561177.1.9481 WP_000561177.1.94815 WP_000561177.1.94820 WP_000561177.1.94835 WP_000561177.1.94849 WP_000561177.1.94850 WP_000561177.1.94851 WP_000561177.1.94862 WP_000561177.1.94864 WP_000561177.1.94947 WP_000561177.1.94952 WP_000561177.1.94959 WP_000561177.1.94967 WP_000561177.1.94971 WP_000561177.1.94982 WP_000561177.1.94986 WP_000561177.1.94987 WP_000561177.1.95006 WP_000561177.1.9503 WP_000561177.1.95051 WP_000561177.1.95055 WP_000561177.1.95076 WP_000561177.1.95085 WP_000561177.1.95099 WP_000561177.1.95121 WP_000561177.1.95136 WP_000561177.1.95152 WP_000561177.1.9516 WP_000561177.1.95165 WP_000561177.1.95171 WP_000561177.1.95235 WP_000561177.1.95239 WP_000561177.1.95246 WP_000561177.1.95248 WP_000561177.1.95249 WP_000561177.1.9525 WP_000561177.1.95255 WP_000561177.1.95265 WP_000561177.1.9527 WP_000561177.1.95277 WP_000561177.1.95282 WP_000561177.1.95298 WP_000561177.1.95320 WP_000561177.1.95338 WP_000561177.1.95388 WP_000561177.1.95404 WP_000561177.1.95412 WP_000561177.1.95434 WP_000561177.1.95447 WP_000561177.1.95456 WP_000561177.1.95465 WP_000561177.1.95530 WP_000561177.1.95546 WP_000561177.1.95547 WP_000561177.1.95579 WP_000561177.1.95590 WP_000561177.1.95607 WP_000561177.1.95623 WP_000561177.1.95625 WP_000561177.1.95630 WP_000561177.1.95641 WP_000561177.1.95656 WP_000561177.1.95670 WP_000561177.1.95675 WP_000561177.1.95691 WP_000561177.1.95701 WP_000561177.1.95703 WP_000561177.1.95716 WP_000561177.1.95729 WP_000561177.1.9574 WP_000561177.1.95757 WP_000561177.1.95776 WP_000561177.1.95803 WP_000561177.1.95826 WP_000561177.1.9586 WP_000561177.1.95866 WP_000561177.1.95884 WP_000561177.1.95890 WP_000561177.1.95901 WP_000561177.1.95906 WP_000561177.1.95911 WP_000561177.1.95939 WP_000561177.1.95940 WP_000561177.1.95963 WP_000561177.1.96004 WP_000561177.1.96025 WP_000561177.1.96042 WP_000561177.1.96044 WP_000561177.1.96045 WP_000561177.1.96054 WP_000561177.1.9609 WP_000561177.1.96094 WP_000561177.1.96107 WP_000561177.1.96127 WP_000561177.1.96139 WP_000561177.1.96141 WP_000561177.1.96144 WP_000561177.1.96162 WP_000561177.1.96172 WP_000561177.1.96188 WP_000561177.1.96190 WP_000561177.1.96203 WP_000561177.1.96206 WP_000561177.1.96211 WP_000561177.1.96212 WP_000561177.1.9624 WP_000561177.1.96260 WP_000561177.1.9627 WP_000561177.1.96317 WP_000561177.1.96319 WP_000561177.1.9633 WP_000561177.1.96335 WP_000561177.1.96340 WP_000561177.1.96343 WP_000561177.1.96348 WP_000561177.1.96349 WP_000561177.1.96359 WP_000561177.1.96380 WP_000561177.1.96404 WP_000561177.1.96429 WP_000561177.1.9644 WP_000561177.1.96469 WP_000561177.1.96497 WP_000561177.1.96500 WP_000561177.1.96521 WP_000561177.1.96533 WP_000561177.1.96537 WP_000561177.1.96539 WP_000561177.1.96552 WP_000561177.1.96555 WP_000561177.1.96563 WP_000561177.1.96588 WP_000561177.1.96590 WP_000561177.1.96600 WP_000561177.1.96610 WP_000561177.1.96625 WP_000561177.1.96635 WP_000561177.1.9664 WP_000561177.1.96642 WP_000561177.1.96662 WP_000561177.1.96675 WP_000561177.1.9670 WP_000561177.1.96721 WP_000561177.1.96732 WP_000561177.1.96735 WP_000561177.1.9674 WP_000561177.1.96750 WP_000561177.1.96758 WP_000561177.1.96771 WP_000561177.1.96792 WP_000561177.1.96798 WP_000561177.1.96801 WP_000561177.1.96803 WP_000561177.1.96810 WP_000561177.1.9686 WP_000561177.1.96876 WP_000561177.1.96890 WP_000561177.1.96902 WP_000561177.1.96917 WP_000561177.1.96925 WP_000561177.1.96938 WP_000561177.1.96946 WP_000561177.1.96957 WP_000561177.1.96978 WP_000561177.1.96993 WP_000561177.1.97005 WP_000561177.1.97015 WP_000561177.1.97026 WP_000561177.1.97028 WP_000561177.1.97043 WP_000561177.1.97047 WP_000561177.1.97079 WP_000561177.1.97089 WP_000561177.1.97103 WP_000561177.1.97109 WP_000561177.1.97143 WP_000561177.1.97145 WP_000561177.1.97154 WP_000561177.1.97184 WP_000561177.1.97185 WP_000561177.1.97190 WP_000561177.1.97224 WP_000561177.1.97260 WP_000561177.1.97287 WP_000561177.1.97291 WP_000561177.1.97297 WP_000561177.1.97318 WP_000561177.1.97322 WP_000561177.1.97328 WP_000561177.1.97337 WP_000561177.1.97368 WP_000561177.1.97369 WP_000561177.1.97386 WP_000561177.1.97413 WP_000561177.1.97422 WP_000561177.1.97441 WP_000561177.1.97477 WP_000561177.1.97480 WP_000561177.1.97487 WP_000561177.1.97496 WP_000561177.1.97497 WP_000561177.1.97505 WP_000561177.1.97547 WP_000561177.1.97594 WP_000561177.1.97597 WP_000561177.1.97599 WP_000561177.1.97606 WP_000561177.1.97613 WP_000561177.1.97615 WP_000561177.1.97620 WP_000561177.1.97626 WP_000561177.1.97631 WP_000561177.1.97640 WP_000561177.1.97646 WP_000561177.1.97648 WP_000561177.1.97656 WP_000561177.1.97690 WP_000561177.1.97691 WP_000561177.1.97704 WP_000561177.1.97725 WP_000561177.1.97726 WP_000561177.1.97727 WP_000561177.1.97732 WP_000561177.1.97736 WP_000561177.1.9774 WP_000561177.1.9775 WP_000561177.1.97772 WP_000561177.1.97819 WP_000561177.1.97840 WP_000561177.1.97846 WP_000561177.1.97873 WP_000561177.1.9793 WP_000561177.1.97938 WP_000561177.1.97981 WP_000561177.1.97983 WP_000561177.1.97986 WP_000561177.1.9799 WP_000561177.1.97991 WP_000561177.1.98006 WP_000561177.1.98019 WP_000561177.1.98022 WP_000561177.1.98036 WP_000561177.1.9805 WP_000561177.1.98080 WP_000561177.1.98086 WP_000561177.1.98107 WP_000561177.1.9811 WP_000561177.1.98110 WP_000561177.1.98119 WP_000561177.1.98124 WP_000561177.1.98146 WP_000561177.1.98158 WP_000561177.1.98201 WP_000561177.1.98219 WP_000561177.1.98236 WP_000561177.1.98250 WP_000561177.1.9826 WP_000561177.1.98263 WP_000561177.1.98314 WP_000561177.1.98338 WP_000561177.1.98392 WP_000561177.1.98403 WP_000561177.1.9841 WP_000561177.1.98418 WP_000561177.1.98440 WP_000561177.1.98446 WP_000561177.1.98448 WP_000561177.1.98457 WP_000561177.1.98472 WP_000561177.1.98483 WP_000561177.1.98495 WP_000561177.1.9850 WP_000561177.1.98502 WP_000561177.1.98513 WP_000561177.1.98531 WP_000561177.1.98551 WP_000561177.1.98570 WP_000561177.1.98577 WP_000561177.1.98607 WP_000561177.1.98608 WP_000561177.1.9863 WP_000561177.1.98634 WP_000561177.1.98677 WP_000561177.1.98726 WP_000561177.1.98731 WP_000561177.1.98751 WP_000561177.1.98760 WP_000561177.1.98762 WP_000561177.1.98763 WP_000561177.1.9877 WP_000561177.1.98779 WP_000561177.1.98801 WP_000561177.1.98818 WP_000561177.1.98843 WP_000561177.1.9887 WP_000561177.1.98899 WP_000561177.1.98931 WP_000561177.1.98947 WP_000561177.1.9899 WP_000561177.1.99040 WP_000561177.1.99057 WP_000561177.1.99071 WP_000561177.1.99072 WP_000561177.1.99083 WP_000561177.1.99097 WP_000561177.1.99098 WP_000561177.1.99107 WP_000561177.1.99163 WP_000561177.1.99164 WP_000561177.1.99184 WP_000561177.1.9919 WP_000561177.1.99197 WP_000561177.1.99198 WP_000561177.1.99215 WP_000561177.1.99276 WP_000561177.1.99278 WP_000561177.1.99320 WP_000561177.1.99335 WP_000561177.1.99339 WP_000561177.1.99350 WP_000561177.1.99360 WP_000561177.1.99363 WP_000561177.1.99369 WP_000561177.1.99370 WP_000561177.1.99388 WP_000561177.1.99397 WP_000561177.1.99426 WP_000561177.1.99456 WP_000561177.1.99463 WP_000561177.1.99469 WP_000561177.1.99483 WP_000561177.1.99490 WP_000561177.1.99493 WP_000561177.1.9954 WP_000561177.1.99546 WP_000561177.1.99561 WP_000561177.1.99579 WP_000561177.1.99595 WP_000561177.1.99613 WP_000561177.1.99626 WP_000561177.1.99630 WP_000561177.1.99637 WP_000561177.1.99646 WP_000561177.1.99657 WP_000561177.1.99660 WP_000561177.1.99676 WP_000561177.1.99712 WP_000561177.1.99747 WP_000561177.1.99764 WP_000561177.1.99783 WP_000561177.1.99813 WP_000561177.1.99829 WP_000561177.1.99837 WP_000561177.1.99841 WP_000561177.1.99858 WP_000561177.1.99889 WP_000561177.1.9992 WP_000561177.1.99924 WP_000561177.1.99958 WP_000561177.1.99961 WP_000561177.1.99996 gi|194737061|ref|YP_002113532.1| gi|525948122|ref|YP_008309653.1| gi|386590435|ref|YP_006086835.1| gi|378698461|ref|YP_005180418.1| gi|207855979|ref|YP_002242630.1| gi|526219388|ref|YP_008264752.1| gi|525839055|ref|YP_008256258.1| gi|525827482|ref|YP_008250108.1| gi|378983105|ref|YP_005246260.1| gi|525816435|ref|YP_008246453.1| gi|161615297|ref|YP_001589262.1| gi|16759478|ref|NP_455095.1| gi|452121238|ref|YP_007471486.1| gi|383495307|ref|YP_005395996.1| gi|29142750|ref|NP_806092.1| gi|378444003|ref|YP_005231635.1| gi|409248948|ref|YP_006884785.1| gi|563652074|ref|YP_008860132.1| gi|528818219|ref|YP_008359422.1| gi|62179111|ref|YP_215528.1| gi|194447795|ref|YP_002044533.1| ABAM02000001|CDS_1060360-1059908 ABAN01000007|CDS_167667-168119 ABAO01000003|CDS_60451-59999 ABEH02000009|CDS_59923-59471 ABEJ01000025|CDS_15527-15075 ABEL01000001|CDS_306310-305858 ABEW01000005|CDS_273507-273055 ABFF01000003|CDS_126830-127282 ABFG01000003|CDS_171441-171893 ABFH02000002|CDS_1572829-1573281 AE006468|CDS_561425-560973 AE014613|CDS_2426452-2426904 AE017220|CDS_605782-605330 AL513382|CDS_554649-554197 AM933172|CDS_540924-540472 AM933173|CDS_559351-558899 CP000857|CDS_555982-555530 CP000886|CDS_2556634-2557086 CP001113|CDS_565822-565370 CP001120|CDS_608673-608221 CP001127|CDS_569663-569211 CP001138|CDS_544298-543846 CP001363|CDS_562119-561667 FN424405|CDS_601930-601478 NZ_ACBF01000006|CDS_53811-54263 gi|538361053|ref|YP_008504338.1| gi|379699721|ref|YP_005241449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]