SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000582700.1.16355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000582700.1.16355
Domain Number - Region: 17-75
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0152
Family Capz beta-1 subunit 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000582700.1.16355
Sequence length 80
Comment hypothetical protein [Bacillus cereus]; AA=GCF_000003955.1; RF=na; TAX=526994; STAX=1396; NAME=Bacillus cereus AH1273; strain=AH1273; AL=Chromosome; RT=Major
Sequence
MIIEFDGYEINEYVIGSNCSINQLIVMYLNVKNEELSNENLVSLFCARYHFENIPKSLQE
NITSDVVIDLDTDYIYIPNR
Download sequence
Identical sequences A0A2B2NM00 C2Z8F6
WP_000582700.1.16355 WP_000582700.1.73952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]