SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000628185.1.101110 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000628185.1.101110
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.46e-118
Family PFOR PP module 0.000000035
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.18e-77
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000119
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.65e-72
Family PFOR Pyr module 0.000000093
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.86e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000197
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.7e-23
Family Ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000628185.1.101110
Sequence length 1174
Comment pyruvate:ferredoxin (flavodoxin) oxidoreductase [Escherichia coli]; AA=GCF_001519815.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=GN02298; AL=Contig; RT=Major
Sequence
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAANVQEAQDFALISHIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILDLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
QAMNDFAAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
YRPFSAKHLLQALPGSVRSVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTLPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMVERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVINAAKIARECGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPAELLTALKSDATPEIRREQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSEALEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
Download sequence
Identical sequences A0A229ERT5 B1LG81 V0TEH7
gi|170683269|ref|YP_001743829.1| 439855.EcSMS35_1775 WP_000628185.1.101110 WP_000628185.1.101727 WP_000628185.1.22280 WP_000628185.1.23330 WP_000628185.1.23724 WP_000628185.1.23985 WP_000628185.1.24088 WP_000628185.1.2597 WP_000628185.1.27188 WP_000628185.1.29164 WP_000628185.1.29603 WP_000628185.1.3201 WP_000628185.1.36699 WP_000628185.1.38185 WP_000628185.1.40842 WP_000628185.1.44784 WP_000628185.1.46994 WP_000628185.1.50947 WP_000628185.1.51690 WP_000628185.1.54993 WP_000628185.1.55563 WP_000628185.1.69341 WP_000628185.1.74549 WP_000628185.1.86227 WP_000628185.1.86234 WP_000628185.1.9199 WP_000628185.1.92305 WP_000628185.1.92638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]