SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000667978.1.75377 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000667978.1.75377
Domain Number - Region: 123-189
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.016
Family Frataxin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000667978.1.75377
Sequence length 338
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_000216555.2; RF=na; TAX=996857; STAX=173; NAME=Leptospira interrogans serovar Copenhageni str. Fiocruz LV3738; strain=Fiocruz LV3738; AL=Scaffold; RT=Minor
Sequence
MKFFRHSLQNVIQYKVPFLILVFLLPSLIFGETILFKSGERAYGTVIDQDSETVTIIRDG
KRIKLGKSKILKIIFKEIKDEQEIAKIIEIEKKKLNKEGKKSDKEEQLDTIYLEQMIKEN
SYKIVQKRLALLEKYLEERDGDWESYITAKRNPWEPVWKSAILPGWGHNTMRQNGWGVSY
STLFFVSLFSYFGLDAAEKDRTKAYDKKIEKIIGQQFTTDLLLGSNTSTVTSPELNLVFE
FNTLRNLNSLNSIRSDEADYKKAKHTAAGVAIGIYLIQLTHAYFTGKTWAQNNVIQTPTG
ENVSEGFGVRGNPLVSKEIAGGVKSIDVGGQMLYTIFF
Download sequence
Identical sequences A0A0E2D5N0 A0A0F6HFJ2 A0A1N6SQ63 M3DJA5 M3HFW0 Q72SQ5
267671.LIC11320 WP_000667978.1.10054 WP_000667978.1.100943 WP_000667978.1.101113 WP_000667978.1.101360 WP_000667978.1.11367 WP_000667978.1.11416 WP_000667978.1.12257 WP_000667978.1.12296 WP_000667978.1.13846 WP_000667978.1.14057 WP_000667978.1.14552 WP_000667978.1.15739 WP_000667978.1.17129 WP_000667978.1.17260 WP_000667978.1.175 WP_000667978.1.1759 WP_000667978.1.17762 WP_000667978.1.18168 WP_000667978.1.18988 WP_000667978.1.19091 WP_000667978.1.19636 WP_000667978.1.19906 WP_000667978.1.20233 WP_000667978.1.20778 WP_000667978.1.2170 WP_000667978.1.23212 WP_000667978.1.23353 WP_000667978.1.2392 WP_000667978.1.24270 WP_000667978.1.24738 WP_000667978.1.250 WP_000667978.1.28 WP_000667978.1.28517 WP_000667978.1.30921 WP_000667978.1.30957 WP_000667978.1.31321 WP_000667978.1.3175 WP_000667978.1.32453 WP_000667978.1.32692 WP_000667978.1.32859 WP_000667978.1.3288 WP_000667978.1.33670 WP_000667978.1.339 WP_000667978.1.34457 WP_000667978.1.35633 WP_000667978.1.36128 WP_000667978.1.3754 WP_000667978.1.37594 WP_000667978.1.38403 WP_000667978.1.39007 WP_000667978.1.39787 WP_000667978.1.39967 WP_000667978.1.40783 WP_000667978.1.41353 WP_000667978.1.41637 WP_000667978.1.42222 WP_000667978.1.42779 WP_000667978.1.43311 WP_000667978.1.43353 WP_000667978.1.4572 WP_000667978.1.46007 WP_000667978.1.46812 WP_000667978.1.46987 WP_000667978.1.47834 WP_000667978.1.48092 WP_000667978.1.48207 WP_000667978.1.49352 WP_000667978.1.50455 WP_000667978.1.50786 WP_000667978.1.50904 WP_000667978.1.51217 WP_000667978.1.51443 WP_000667978.1.52005 WP_000667978.1.52351 WP_000667978.1.53255 WP_000667978.1.55693 WP_000667978.1.55703 WP_000667978.1.56120 WP_000667978.1.59857 WP_000667978.1.60804 WP_000667978.1.6135 WP_000667978.1.61658 WP_000667978.1.63084 WP_000667978.1.63541 WP_000667978.1.63646 WP_000667978.1.64760 WP_000667978.1.65294 WP_000667978.1.65513 WP_000667978.1.6574 WP_000667978.1.668 WP_000667978.1.67243 WP_000667978.1.67344 WP_000667978.1.6761 WP_000667978.1.68426 WP_000667978.1.69136 WP_000667978.1.70516 WP_000667978.1.72166 WP_000667978.1.72187 WP_000667978.1.7280 WP_000667978.1.72830 WP_000667978.1.73036 WP_000667978.1.73107 WP_000667978.1.73302 WP_000667978.1.74258 WP_000667978.1.74515 WP_000667978.1.74558 WP_000667978.1.74792 WP_000667978.1.75054 WP_000667978.1.75316 WP_000667978.1.75377 WP_000667978.1.76404 WP_000667978.1.76970 WP_000667978.1.76971 WP_000667978.1.7707 WP_000667978.1.77242 WP_000667978.1.78069 WP_000667978.1.7821 WP_000667978.1.78551 WP_000667978.1.78739 WP_000667978.1.79237 WP_000667978.1.79939 WP_000667978.1.81443 WP_000667978.1.82393 WP_000667978.1.82978 WP_000667978.1.83201 WP_000667978.1.84222 WP_000667978.1.84450 WP_000667978.1.86863 WP_000667978.1.87123 WP_000667978.1.8721 WP_000667978.1.8748 WP_000667978.1.87797 WP_000667978.1.87860 WP_000667978.1.88844 WP_000667978.1.89725 WP_000667978.1.90537 WP_000667978.1.90803 WP_000667978.1.91009 WP_000667978.1.91013 WP_000667978.1.91017 WP_000667978.1.91046 WP_000667978.1.91324 WP_000667978.1.92480 WP_000667978.1.9249 WP_000667978.1.95586 WP_000667978.1.95836 WP_000667978.1.9683 WP_000667978.1.97198 WP_000667978.1.97216 WP_000667978.1.97385 WP_000667978.1.97703 WP_000667978.1.9886 gi|45657200|ref|YP_001286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]