SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000695046.1.20438 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000695046.1.20438
Domain Number 1 Region: 163-411
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.06e-81
Family D-glucarate dehydratase-like 0.000000000464
Further Details:      
 
Domain Number 2 Region: 1-160
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.12e-63
Family Enolase N-terminal domain-like 0.0000000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000695046.1.20438
Sequence length 413
Comment methylaspartate ammonia-lyase [Salmonella enterica]; AA=GCF_001951545.1; RF=na; TAX=1395117; STAX=28901; NAME=Salmonella enterica subsp. arizonae serovar 18:z4,z23:- str. CVM N26624; strain=N26624; AL=Contig; RT=Major
Sequence
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGAPVTPGFTSVRQAGECVSVQLILE
NGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNNHIKPLLEGRDVDTFLPNARFFDKLR
IDGNLLHTAVRYGLSQALLDATALATGRLKTEVVYDEWQLPCVPEAIPLFGQSGDDRYIA
VDKMILKGVDVLPHALINNVEEKLGFQGEKLREYVRWLSDRILRLRTSPRYHPTLHIDVY
GTIGLIFDMDPLRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRLLTAITKELTRLGS
GVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGT
CNETEISARTCVHVALAARPMRMLVKPGMGFDEGLNIVFNEMNRTIALLQAKD
Download sequence
Identical sequences A0A089GDS8 A0A0V2EA82 A0A1M3XY36 A0A1X2TK57 A0A221ZCS2 A0A2K2RZJ0 A0A2K2S846 A0A2K2SIL1 A0A2K2SZ93 A0A2K2TCQ0 A9MJL0
WP_000695046.1.100979 WP_000695046.1.101363 WP_000695046.1.1204 WP_000695046.1.13465 WP_000695046.1.1832 WP_000695046.1.18796 WP_000695046.1.20438 WP_000695046.1.2155 WP_000695046.1.22026 WP_000695046.1.26414 WP_000695046.1.27123 WP_000695046.1.2915 WP_000695046.1.2974 WP_000695046.1.3208 WP_000695046.1.4114 WP_000695046.1.45947 WP_000695046.1.49041 WP_000695046.1.52052 WP_000695046.1.5907 WP_000695046.1.59204 WP_000695046.1.64036 WP_000695046.1.64715 WP_000695046.1.65308 WP_000695046.1.6558 WP_000695046.1.70262 WP_000695046.1.70692 WP_000695046.1.73242 WP_000695046.1.74673 WP_000695046.1.75150 WP_000695046.1.77861 WP_000695046.1.79300 WP_000695046.1.80363 WP_000695046.1.81612 WP_000695046.1.90617 WP_000695046.1.90752 WP_000695046.1.9276 WP_000695046.1.94461 WP_000695046.1.98266 WP_000695046.1.98558 41514.SARI_02201 CP000880|CDS_2130628-2131869 gi|161504103|ref|YP_001571215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]