SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000704451.1.27987 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000704451.1.27987
Domain Number 1 Region: 112-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.19e-69
Family D-glucarate dehydratase-like 0.0000148
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.98e-37
Family Enolase N-terminal domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000704451.1.27987
Sequence length 369
Comment dipeptide epimerase [Bacillus anthracis]; AA=GCF_000783115.1; RF=na; TAX=1392; STAX=1392; NAME=Bacillus anthracis; strain=2000032951; AL=Scaffold; RT=Major
Sequence
MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIVKMETDEGIIGYGEGVADDHVTGESWE
STFHILKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAIDIACFDIMGKKLNQPVY
QLIGGRYHEEFPITHVLSIADPEEMAEEAASMIQKGYQSFKMKVGTNVKEDVKRIEAVRE
RVGNDIAIRVDVNQGWKNSANTLMALRSLGHLNIDWIEQPVIADDIDAMAHIRSKTDLPL
MIDEGLKGSREMRQIINLDAADKVNIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESS
VASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPFIRLNEKPGLGIEINEDTLRE
LTVFQDIVR
Download sequence
Identical sequences A0A0F7RNS0 Q81ZD0
gi|227813004|ref|YP_002813013.1| gi|30260509|ref|NP_842886.1| gi|229603993|ref|YP_002864954.1| gi|386734188|ref|YP_006207369.1| 198094.BA_0339 260799.BAS0324 261594.GBAA0339 568206.BAMEG_0399 592021.BAA_0396 gi|49183352|ref|YP_026604.1| gi|47525606|ref|YP_016955.1| NP_842886.1.87267 WP_000704451.1.100214 WP_000704451.1.100595 WP_000704451.1.10208 WP_000704451.1.11427 WP_000704451.1.11676 WP_000704451.1.13115 WP_000704451.1.13233 WP_000704451.1.13820 WP_000704451.1.14721 WP_000704451.1.14855 WP_000704451.1.15460 WP_000704451.1.15569 WP_000704451.1.16170 WP_000704451.1.16997 WP_000704451.1.17146 WP_000704451.1.18976 WP_000704451.1.19258 WP_000704451.1.19435 WP_000704451.1.19445 WP_000704451.1.20390 WP_000704451.1.20680 WP_000704451.1.21021 WP_000704451.1.21258 WP_000704451.1.21776 WP_000704451.1.22865 WP_000704451.1.23269 WP_000704451.1.2419 WP_000704451.1.24334 WP_000704451.1.24556 WP_000704451.1.24608 WP_000704451.1.25716 WP_000704451.1.25752 WP_000704451.1.2618 WP_000704451.1.26665 WP_000704451.1.26721 WP_000704451.1.27644 WP_000704451.1.27987 WP_000704451.1.28427 WP_000704451.1.28729 WP_000704451.1.29101 WP_000704451.1.29787 WP_000704451.1.30110 WP_000704451.1.31490 WP_000704451.1.3236 WP_000704451.1.32576 WP_000704451.1.33175 WP_000704451.1.33338 WP_000704451.1.33367 WP_000704451.1.33740 WP_000704451.1.33876 WP_000704451.1.34646 WP_000704451.1.35684 WP_000704451.1.35886 WP_000704451.1.36305 WP_000704451.1.36763 WP_000704451.1.38036 WP_000704451.1.39781 WP_000704451.1.40550 WP_000704451.1.41165 WP_000704451.1.41675 WP_000704451.1.4439 WP_000704451.1.45305 WP_000704451.1.46236 WP_000704451.1.46699 WP_000704451.1.47145 WP_000704451.1.4763 WP_000704451.1.47644 WP_000704451.1.47798 WP_000704451.1.51749 WP_000704451.1.52794 WP_000704451.1.53137 WP_000704451.1.53493 WP_000704451.1.53683 WP_000704451.1.54117 WP_000704451.1.54189 WP_000704451.1.55811 WP_000704451.1.55958 WP_000704451.1.56042 WP_000704451.1.56176 WP_000704451.1.56270 WP_000704451.1.56959 WP_000704451.1.58160 WP_000704451.1.59095 WP_000704451.1.59310 WP_000704451.1.59575 WP_000704451.1.60402 WP_000704451.1.61213 WP_000704451.1.63560 WP_000704451.1.68607 WP_000704451.1.69203 WP_000704451.1.69822 WP_000704451.1.69894 WP_000704451.1.70065 WP_000704451.1.70996 WP_000704451.1.72704 WP_000704451.1.73325 WP_000704451.1.74226 WP_000704451.1.74538 WP_000704451.1.75499 WP_000704451.1.75870 WP_000704451.1.76125 WP_000704451.1.76783 WP_000704451.1.77668 WP_000704451.1.77824 WP_000704451.1.78644 WP_000704451.1.79315 WP_000704451.1.79584 WP_000704451.1.80439 WP_000704451.1.80695 WP_000704451.1.81799 WP_000704451.1.82289 WP_000704451.1.83951 WP_000704451.1.84045 WP_000704451.1.85689 WP_000704451.1.86119 WP_000704451.1.86140 WP_000704451.1.86239 WP_000704451.1.86288 WP_000704451.1.8698 WP_000704451.1.8825 WP_000704451.1.88641 WP_000704451.1.90791 WP_000704451.1.90883 WP_000704451.1.9186 WP_000704451.1.92686 WP_000704451.1.92831 WP_000704451.1.93271 WP_000704451.1.93744 WP_000704451.1.93927 WP_000704451.1.94237 WP_000704451.1.94322 WP_000704451.1.94784 WP_000704451.1.96934 WP_000704451.1.97781 WP_000704451.1.97861 WP_000704451.1.98216 WP_000704451.1.99445 WP_000704451.1.99485 WP_000704451.1.99994 YP_026604.1.16718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]