SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000704465.1.34158 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000704465.1.34158
Domain Number 1 Region: 112-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.32e-69
Family D-glucarate dehydratase-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.69e-37
Family Enolase N-terminal domain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000704465.1.34158
Sequence length 369
Comment MULTISPECIES: dipeptide epimerase [Bacillus cereus group]; AA=GCF_001758315.1; RF=na; TAX=1392; STAX=1392; NAME=Bacillus anthracis; strain=PFAB2; AL=Contig; RT=Major
Sequence
MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIVKMETDEGIIGYGEGVADDHVTGESWE
STFHTLKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAIDIACFDIMGKKLNQPVY
QLIGGRYHEEFPITHVLSIADPEEMAEEAASMIQKGYQSFKMKVGTNVKEDVKRIEAVRE
RVGNDIAIRVDVNQGWKNSANTLTALRSLGHVNIDWIEQPVIADDIDAMAHIRSKTDLPL
MIDEGLKGSREMRQIIKVDAADKVNIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESS
VASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPFIRLNEKPGLGIEINEDTLRE
LTVFQGSVR
Download sequence
Identical sequences A0A0U0G932 A0A1Y5YY63 Q6HP62
gi|49480074|ref|YP_034658.1| WP_000704465.1.34158 WP_000704465.1.43104 WP_000704465.1.66331 WP_000704465.1.94373 YP_034658.1.62562 281309.BT9727_0308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]