SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000704500.1.89145 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000704500.1.89145
Domain Number 1 Region: 112-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.23e-69
Family D-glucarate dehydratase-like 0.0000135
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-37
Family Enolase N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000704500.1.89145
Sequence length 369
Comment MULTISPECIES: dipeptide epimerase [Bacillus]; AA=GCF_000940785.1; RF=na; TAX=1441; STAX=1428; NAME=Bacillus thuringiensis serovar morrisoni; strain=BGSC 4AA1; AL=Complete Genome; RT=Major
Sequence
MKITAIHLYAIRLPLRSPFVISYGSYSDMPSIIVKMETDEGIIGYGEGVADDHVTGESWE
STFHTLKHTLTPALIGKNPMNIEKIHDMMDNTIYGVPTAKAAIDIACFDIMGKKLNQPVY
QLIGGRYHEEFPVTHVLSIADPEDMAEEAASMIQKGYQSFKMKVGTNVKEDVKRIEAVRE
RVGNDIAIRIDVNQGWKNSANTLTALRSLGHLNIDWIEQPVIADDIDAMAHIRSKTDLPL
MIDEGLKSSREMRQIIKLEAADKVNIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESS
VASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPFIRLNEKPGLGIEINEDTLQE
LTVFQDVVR
Download sequence
Identical sequences A0A0Q0QUQ9 A0A0Q9G4B6 A0A0Q9GHE2 A0A160L654 A0A242Y7T3 A0A243AYU2 A0A243MNN7 B7IUZ9 C3DEE9 J3UQH9 J7T4G3 Q3EKU1 R8XQ22
gi|218895447|ref|YP_002443858.1| 405531.BCG9842_B4932 gi|402562580|ref|YP_006605304.1| gi|434378987|ref|YP_006613631.1| WP_000704500.1.101838 WP_000704500.1.13269 WP_000704500.1.22084 WP_000704500.1.26459 WP_000704500.1.27446 WP_000704500.1.28599 WP_000704500.1.34537 WP_000704500.1.3546 WP_000704500.1.36279 WP_000704500.1.38325 WP_000704500.1.48759 WP_000704500.1.50042 WP_000704500.1.52284 WP_000704500.1.58712 WP_000704500.1.59384 WP_000704500.1.60526 WP_000704500.1.61799 WP_000704500.1.6241 WP_000704500.1.64421 WP_000704500.1.73638 WP_000704500.1.83666 WP_000704500.1.87649 WP_000704500.1.87705 WP_000704500.1.89145 WP_000704500.1.9703 WP_000704500.1.97821 WP_000704500.1.97830 WP_000704500.1.98315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]