SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000742586.1.101717 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000742586.1.101717
Domain Number 1 Region: 22-166
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.45e-22
Family N-acetyl transferase, NAT 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000742586.1.101717
Sequence length 180
Comment UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase [Helicobacter pylori]; AA=GCF_000213135.1; RF=na; TAX=585538; STAX=210; NAME=Helicobacter pylori 83; strain=83; AL=Complete Genome; RT=Major
Sequence
MKKNYCYKNIQAIDFTYLNDEEKLLVLEFRNHPNTALWMYSAFISLKTHLQFIEDLKNSP
NHRYFLFKEEGVYLGVGSITKINFFHKHGYLGIYKNPFLKNRGETILKALERIAFEEFQL
NSLHLEVMENNFKAIAFYEKNHYELEGRLKGFISKEKEFIDVLLYYKDKKGYNDQSALKF
Download sequence
Identical sequences F4D4R5
gi|385225027|ref|YP_005784952.1| WP_000742586.1.101717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]