SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000746904.1.11427 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000746904.1.11427
Domain Number 1 Region: 625-761
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 2-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.13e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.001
Further Details:      
 
Domain Number 3 Region: 141-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.1e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0028
Further Details:      
 
Domain Number 4 Region: 492-615
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.32e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000746904.1.11427
Sequence length 801
Comment MULTISPECIES: nitrite reductase large subunit [Bacillus cereus group]; AA=GCF_001936375.1; RF=na; TAX=1392; STAX=1392; NAME=Bacillus anthracis; strain=Tyrol 4675; AL=Complete Genome; RT=Major
Sequence
MKKRLVMIGNGMAGIRCMEEILKHDCDSYEITIFGDEPHPNYNRIMLSHVLQGKTNIQDI
IMNEYSWYEENEITLYTNERVQSIDREEKVIMTEKNRTLTYDKLIIATGSSAFILPVEGS
TLPGVTGFRTIEDTQFMMDTAKEKKKAVVIGGGLLGLEAARGLIDLGMDVHVVHLMPSLM
EQQLDTKAASLLREDLEAQGMKFLMEKKTVKILGTNHVEGIQFEDGEVVDCDLIVMAVGI
RPNTQIARDAGLIVNRGIVVNDYMLTNDESIYAVGECAEHDGIAYGLVAPLYEQGAILAK
HISNLQTDGYSGSIVGTQLKVAGCDLFSAGQIYEDDQTKAISIFNECKRSYKKVLIRDNK
VVGIVLYGDTADGTRLFSMLKKEEDIQEYTPASILHKAGEESELDVATMSADDTICGCNG
VTKGTIVHAILEQELTTFEEVKGCTKAAGSCGKCRPLVEQVLSHTLGDAFDASAQSAGMC
GCTPLSRDEVVAAIHEKGLKSPKEVRNVLGFVHEDGCSKCRPALNYYLRMAIPEEYEDDK
ASRFVNERMNGNIQHDGTFSVIPRMYGGVTTADDLMKIAEVAKKYDVPLVKITGASRIGL
YGVKKQDLPNVWADLNMTSGYAYSKSLRNVKSCVGSRFCRFGTKDSLGLGMLLEQSLEMV
DTPHKMKMGVTGCPRNCAEVLTKDFGVVCVENGYQLYIGGNGGTEVREADFVMIVPTEDD
VLHIATAYMQYYRETGIYGERTAYWTERLGFDHIKEILQDANMVTKLNERFQTARGTYKE
AWGQALETKSLKAMYEVETVK
Download sequence
Identical sequences A0A158RUW9 A0RDD0 C2NGY5
412694.BALH_1907 572264.BCA_2230 gi|118477579|ref|YP_894730.1| gi|376266041|ref|YP_005118753.1| WP_000746904.1.11427 WP_000746904.1.13233 WP_000746904.1.15163 WP_000746904.1.19445 WP_000746904.1.23269 WP_000746904.1.24676 WP_000746904.1.2569 WP_000746904.1.31490 WP_000746904.1.33175 WP_000746904.1.33828 WP_000746904.1.3699 WP_000746904.1.40550 WP_000746904.1.44483 WP_000746904.1.46476 WP_000746904.1.47644 WP_000746904.1.51749 WP_000746904.1.56959 WP_000746904.1.62300 WP_000746904.1.69323 WP_000746904.1.70996 WP_000746904.1.80439 WP_000746904.1.86239 WP_000746904.1.90883 WP_000746904.1.99994 gi|225864126|ref|YP_002749504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]