SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000756974.1.63560 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000756974.1.63560
Domain Number 1 Region: 34-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.71e-78
Family Phosphate binding protein-like 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000756974.1.63560
Sequence length 270
Comment MULTISPECIES: metal ABC transporter substrate-binding protein [Bacillus cereus group]; AA=GCF_000833065.1; RF=na; TAX=1392; STAX=1392; NAME=Bacillus anthracis; strain=Ames; AL=Complete Genome; RT=Major
Sequence
MKKVLLSIVSGAVLLLGACSAGSDKEVKALDEKKITVGVTGGPHEQIFEKVKEVAAKDGL
EIDVKVFNDYVAPNVSLDEKSLDVNSYQTKSYLDVFKAERNMKLTEVFSTVTFPMGVYSK
SLKDVKDLKDGDAIAVPNDPTNELRALKLFEKAGVLKVDPKATEKATAKDVIENPKNLKI
VELEASQLPTQLSEVKAAAINTNFALGAKLSPAKDSIFREGKDSPYVNWVVVRTENKDDA
VVNKLKKAYQSKEVKEFIEKKFDGSVLPSW
Download sequence
Identical sequences A0A0B5W4Y7 A0A0G8DEF0 A0A0K6MR15 A0A1Q4MB94 A0A242W0G6 A0A243D2G7 A0R8P3 B3ZSW4 B7JL80 C2NBW4 C2TAJ7 C2VMX0 C3GD45 Q63H28 Q81VM1
gi|227812849|ref|YP_002812858.1| gi|218901377|ref|YP_002449211.1| IDP05714 gi|229601365|ref|YP_002864819.1| gi|118475942|ref|YP_893093.1| gi|52145045|ref|YP_081783.1| gi|386734042|ref|YP_006207223.1| gi|30260362|ref|NP_842739.1| 198094.BA_0175 260799.BAS0177 261594.GBAA0175 288681.BCZK0167 405535.BCAH820_0196 412694.BALH_0174 568206.BAMEG_0207 592021.BAA_0207 NP_842739.1.87267 WP_000756974.1.100059 WP_000756974.1.100214 WP_000756974.1.100409 WP_000756974.1.100595 WP_000756974.1.101931 WP_000756974.1.10208 WP_000756974.1.11387 WP_000756974.1.11427 WP_000756974.1.11676 WP_000756974.1.13115 WP_000756974.1.13221 WP_000756974.1.13233 WP_000756974.1.13820 WP_000756974.1.14721 WP_000756974.1.14855 WP_000756974.1.15460 WP_000756974.1.15569 WP_000756974.1.16013 WP_000756974.1.16170 WP_000756974.1.16997 WP_000756974.1.17146 WP_000756974.1.18976 WP_000756974.1.19258 WP_000756974.1.19435 WP_000756974.1.19445 WP_000756974.1.20390 WP_000756974.1.20680 WP_000756974.1.21021 WP_000756974.1.21258 WP_000756974.1.21776 WP_000756974.1.22865 WP_000756974.1.23269 WP_000756974.1.23615 WP_000756974.1.23873 WP_000756974.1.2419 WP_000756974.1.24334 WP_000756974.1.24556 WP_000756974.1.24608 WP_000756974.1.24676 WP_000756974.1.25716 WP_000756974.1.25752 WP_000756974.1.26000 WP_000756974.1.26665 WP_000756974.1.26721 WP_000756974.1.27644 WP_000756974.1.27987 WP_000756974.1.28427 WP_000756974.1.29101 WP_000756974.1.29451 WP_000756974.1.29787 WP_000756974.1.29804 WP_000756974.1.30110 WP_000756974.1.30336 WP_000756974.1.31490 WP_000756974.1.3236 WP_000756974.1.32576 WP_000756974.1.33175 WP_000756974.1.33338 WP_000756974.1.33367 WP_000756974.1.33536 WP_000756974.1.33740 WP_000756974.1.33828 WP_000756974.1.33876 WP_000756974.1.34646 WP_000756974.1.35684 WP_000756974.1.35886 WP_000756974.1.36305 WP_000756974.1.36763 WP_000756974.1.38036 WP_000756974.1.39781 WP_000756974.1.40550 WP_000756974.1.41165 WP_000756974.1.41365 WP_000756974.1.41675 WP_000756974.1.42217 WP_000756974.1.4439 WP_000756974.1.45305 WP_000756974.1.45533 WP_000756974.1.45919 WP_000756974.1.46236 WP_000756974.1.46476 WP_000756974.1.46699 WP_000756974.1.47145 WP_000756974.1.4763 WP_000756974.1.47644 WP_000756974.1.47798 WP_000756974.1.4865 WP_000756974.1.49831 WP_000756974.1.51749 WP_000756974.1.52794 WP_000756974.1.53137 WP_000756974.1.53493 WP_000756974.1.53683 WP_000756974.1.54117 WP_000756974.1.54189 WP_000756974.1.55811 WP_000756974.1.55958 WP_000756974.1.55968 WP_000756974.1.56042 WP_000756974.1.56176 WP_000756974.1.56270 WP_000756974.1.56959 WP_000756974.1.58160 WP_000756974.1.59095 WP_000756974.1.59310 WP_000756974.1.59575 WP_000756974.1.59978 WP_000756974.1.60402 WP_000756974.1.61213 WP_000756974.1.62300 WP_000756974.1.63137 WP_000756974.1.63560 WP_000756974.1.63611 WP_000756974.1.66357 WP_000756974.1.67239 WP_000756974.1.68607 WP_000756974.1.69203 WP_000756974.1.69822 WP_000756974.1.69894 WP_000756974.1.70065 WP_000756974.1.70996 WP_000756974.1.72704 WP_000756974.1.74226 WP_000756974.1.74538 WP_000756974.1.7545 WP_000756974.1.75499 WP_000756974.1.75870 WP_000756974.1.76125 WP_000756974.1.76783 WP_000756974.1.77824 WP_000756974.1.782 WP_000756974.1.7856 WP_000756974.1.78644 WP_000756974.1.79315 WP_000756974.1.79584 WP_000756974.1.80439 WP_000756974.1.80695 WP_000756974.1.81799 WP_000756974.1.82289 WP_000756974.1.84045 WP_000756974.1.85689 WP_000756974.1.85901 WP_000756974.1.86119 WP_000756974.1.86140 WP_000756974.1.86239 WP_000756974.1.86288 WP_000756974.1.8698 WP_000756974.1.8825 WP_000756974.1.88641 WP_000756974.1.90791 WP_000756974.1.90883 WP_000756974.1.9186 WP_000756974.1.92686 WP_000756974.1.9269 WP_000756974.1.92831 WP_000756974.1.93271 WP_000756974.1.93744 WP_000756974.1.93927 WP_000756974.1.94237 WP_000756974.1.94322 WP_000756974.1.94784 WP_000756974.1.95308 WP_000756974.1.96934 WP_000756974.1.97781 WP_000756974.1.97861 WP_000756974.1.98216 WP_000756974.1.99445 WP_000756974.1.99485 WP_000756974.1.99994 YP_026462.1.16718 gi|47525435|ref|YP_016784.1| gi|49183210|ref|YP_026462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]