SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000823755.1.33790 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000823755.1.33790
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.89e-70
Family Phosphate binding protein-like 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000823755.1.33790
Sequence length 264
Comment MULTISPECIES: ABC transporter substrate-binding protein [Bacillus cereus group]; AA=GCF_000571955.1; RF=na; TAX=1306023; STAX=1428; NAME=Bacillus thuringiensis serovar tolworthi NA205-3; strain=NA205-3; AL=Contig; RT=Major
Sequence
MKRKLLTIVASITLCTSFILGACSKESSTTSSNGEKEFRYAMSGLYKPFNYKENDGKLVG
FDVEIGEALAKKMNMKATPVTNPWETLIQGLQAKKYDVILGSMAITEERLKAVSFSNPYY
RSGAQIFVAKKNTAISSPEDLKGKKIGVVKASTFKNLVAKYTDQITEYDSDITALMDLEP
GRVDAVITDQMVGLRMIKEGKSNIKEAGKPLNLDEMGIAIRKDDKEMVEQVNKALDEIIK
DGTYEKISKKWFGRNILGEEEKTK
Download sequence
Identical sequences A0A0F6J3J5 A0A160GV99 A0A1B1KZU9 A0A242ZSS4 M1QPY4 V5M3D8
gi|452196727|ref|YP_007476808.1| gi|558678734|ref|YP_008816863.1| WP_000823755.1.11442 WP_000823755.1.23245 WP_000823755.1.23360 WP_000823755.1.3249 WP_000823755.1.33790 WP_000823755.1.41729 WP_000823755.1.57561 WP_000823755.1.5895 WP_000823755.1.62277 WP_000823755.1.71652 WP_000823755.1.80622 WP_000823755.1.84541 WP_000823755.1.84775 WP_000823755.1.8577 WP_000823755.1.91020 WP_000823755.1.9700 WP_000823755.1.97816 gi|410672721|ref|YP_006925092.1| gi|384184433|ref|YP_005570329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]