SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000826657.1.91969 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000826657.1.91969
Domain Number 1 Region: 34-245
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.11e-29
Family Phosphate binding protein-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000826657.1.91969
Sequence length 324
Comment hypothetical protein [Staphylococcus aureus]; AA=GCF_900043945.1; RF=na; TAX=1280; STAX=1280; NAME=Staphylococcus aureus; strain=st27; AL=Contig; RT=Major
Sequence
MKRLSIIVIIGIFIITGCDWQRASKEPSNNAQHQQVIKIGYLPITHSANLMMTKKLLSQH
NHPKYKLELVKFNNWPDLMDALNSGRIDGASTLIELAMKSKQKGSNIKAVALGHHEGNVI
MGQKGMHLNEFNNNGDDYHFGIPHRYSTHYLLLEALREQLKIKPGHFSYHEMSPAEMPAA
LSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCVLVLRGELLDQHKAVAQAF
AQDYKKSGFKMNDRKQSVDIMTHHFKQSRDVLTQSAAWTSYGDLTIKPSGYQEITTLVKQ
HHLFNPPAYDDFVEPSLYKEASRS
Download sequence
Identical sequences A0A0E1AHE1 A0A0Z4ELU4
gi|554642977|ref|YP_008714768.1| gi|521210988|ref|YP_008167334.1| gi|387141812|ref|YP_005730205.1| WP_000826657.1.100352 WP_000826657.1.101757 WP_000826657.1.10486 WP_000826657.1.1136 WP_000826657.1.12179 WP_000826657.1.12226 WP_000826657.1.1355 WP_000826657.1.13726 WP_000826657.1.17520 WP_000826657.1.17650 WP_000826657.1.18538 WP_000826657.1.18627 WP_000826657.1.19807 WP_000826657.1.19853 WP_000826657.1.21081 WP_000826657.1.22332 WP_000826657.1.22351 WP_000826657.1.23489 WP_000826657.1.28025 WP_000826657.1.28477 WP_000826657.1.30154 WP_000826657.1.30779 WP_000826657.1.31990 WP_000826657.1.32454 WP_000826657.1.33372 WP_000826657.1.33426 WP_000826657.1.34438 WP_000826657.1.34847 WP_000826657.1.35837 WP_000826657.1.35933 WP_000826657.1.36814 WP_000826657.1.39642 WP_000826657.1.4202 WP_000826657.1.44178 WP_000826657.1.44655 WP_000826657.1.44940 WP_000826657.1.4545 WP_000826657.1.49362 WP_000826657.1.50178 WP_000826657.1.51741 WP_000826657.1.53532 WP_000826657.1.54290 WP_000826657.1.54929 WP_000826657.1.58185 WP_000826657.1.58481 WP_000826657.1.58603 WP_000826657.1.61413 WP_000826657.1.62781 WP_000826657.1.63233 WP_000826657.1.64628 WP_000826657.1.64643 WP_000826657.1.64998 WP_000826657.1.65264 WP_000826657.1.65358 WP_000826657.1.65946 WP_000826657.1.67864 WP_000826657.1.69409 WP_000826657.1.70059 WP_000826657.1.70664 WP_000826657.1.71721 WP_000826657.1.72204 WP_000826657.1.72340 WP_000826657.1.72453 WP_000826657.1.7254 WP_000826657.1.73002 WP_000826657.1.7360 WP_000826657.1.75800 WP_000826657.1.76674 WP_000826657.1.77158 WP_000826657.1.78335 WP_000826657.1.79581 WP_000826657.1.80210 WP_000826657.1.81290 WP_000826657.1.81837 WP_000826657.1.83086 WP_000826657.1.85118 WP_000826657.1.85585 WP_000826657.1.86779 WP_000826657.1.87204 WP_000826657.1.89262 WP_000826657.1.91969 WP_000826657.1.93567 WP_000826657.1.9392 WP_000826657.1.94324 WP_000826657.1.95008 WP_000826657.1.95495 WP_000826657.1.9563 WP_000826657.1.96368 WP_000826657.1.96412 WP_000826657.1.96688 WP_000826657.1.97295 WP_000826657.1.97999 gi|532358339|ref|YP_008448168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]