SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000847055.1.69591 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000847055.1.69591
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 6.28e-36
Family At5g01750-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000847055.1.69591
Sequence length 161
Comment UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus pneumoniae]; AA=GCF_000019825.1; RF=na; TAX=512566; STAX=1313; NAME=Streptococcus pneumoniae G54; strain=G54; AL=Complete Genome; RT=Major
Sequence
MKTFLVKQKFRLGGERFAIKDDRGEIAYQVEGSFFKIPKTFTIYDAAGEQVSEISKEILT
LLPRFEIQLRDGSSFVIRKKLTFWRDKYEFDNXGLRIEGNIWDLNFKLLDDRDQLIAEIK
KELFHLTSTYTVTVLEDAYADLVISLCVAIDYVEMLESQSH
Download sequence
Identical sequences 512566.SPG_1324 gi|194398166|ref|YP_002038031.1| WP_000847055.1.69591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]