SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000915066.1.33790 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000915066.1.33790
Domain Number 1 Region: 41-307
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.23e-51
Family Transferrin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000915066.1.33790
Sequence length 312
Comment MULTISPECIES: phosphonate ABC transporter substrate-binding protein [Bacillus cereus group]; AA=GCF_000571955.1; RF=na; TAX=1306023; STAX=1428; NAME=Bacillus thuringiensis serovar tolworthi NA205-3; strain=NA205-3; AL=Contig; RT=Major
Sequence
MLKKVFAMSTTVVLAAGLLSGCGTKESSASKNEDTKKGYVPKTLNVQFVPSQNADTLEAK
AKPLEKLLSDKLNIPVKVSISTNYNTIVEAMASKQVDVGFLPPTAYVLAHEKKAANVILQ
AQRFGVEDETGAPTKDLVDYYKSEFVVKKDSNINSVKDLKGKKIGYQDVTSSAGYVWPAA
VLLKEGIDPLKDVKPVTLKGHDQSLIALLNGDVDAAVVFQDARNIVKKDYPNIFEQTKIV
KFTEKIPNDTISVRSDLDEEWSKKLQDAFIEIGKNEEGRKIIKEVYSHEGYIKSDDSKFD
IVREYGKTVKTQ
Download sequence
Identical sequences A0A0F6J5Z7 A0A1C9BX85 A0A1W6WQV6 M1QQ39
gi|452200071|ref|YP_007480152.1| WP_000915066.1.13975 WP_000915066.1.23360 WP_000915066.1.33790 WP_000915066.1.41090 WP_000915066.1.57561 WP_000915066.1.5895 WP_000915066.1.62277 WP_000915066.1.70108 WP_000915066.1.71652 WP_000915066.1.80622 WP_000915066.1.84541 WP_000915066.1.8577 WP_000915066.1.91020 gi|384187692|ref|YP_005573588.1| gi|410676013|ref|YP_006928384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]