SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000916476.1.33828 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000916476.1.33828
Domain Number 1 Region: 4-273
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.74e-71
Family Phosphate binding protein-like 0.0000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000916476.1.33828
Sequence length 276
Comment MULTISPECIES: glutamine ABC transporter substrate-binding protein [Bacillus cereus group]; AA=GCF_000832825.1; RF=na; TAX=1428; STAX=1428; NAME=Bacillus thuringiensis; strain=HD571; AL=Complete Genome; RT=Major
Sequence
MLKMKKLFTLIVFSCLFVLVVAGCGSKKDEAKETNTKQGGAVEQIKKRGKLVVGVKNDTN
LFGLKNPSTGQVEGFDVDIAKALAKKILGDEKKLELKEVTSKTRIPLLKNGDIDAIIATM
TITEERKKEVDFSDVYFKAGQSLLVKKGSDIKSIDDVKKGVKVLAVKGSTSTNNIRQKSP
EATVLEFENYSEAFTALKAGKGDVLTTDNAILYGMAKQDSNYEVVGKIFTDEPYGIAVQK
GADDLTKEINSLIKDMKANGEYDKLYEKWIGQKPEK
Download sequence
Identical sequences A0A1J9WZY8 A0R9S7
WP_000916476.1.33828 WP_000916476.1.3699 WP_000916476.1.46476 WP_000916476.1.59978 gi|118476326|ref|YP_893477.1| 412694.BALH_0581 gi|376264605|ref|YP_005117317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]