SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000921790.1.56689 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000921790.1.56689
Domain Number 1 Region: 95-226,269-383
Classification Level Classification E-value
Superfamily TPR-like 0.000000000625
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Weak hits

Sequence:  WP_000921790.1.56689
Domain Number - Region: 8-63
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0837
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000921790.1.56689
Sequence length 398
Comment protoheme IX biogenesis protein HemY [Escherichia coli]; AA=GCF_001440495.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=ECGM-D3374; AL=Contig; RT=Major
Sequence
MLKVLLLFVLLIAGIVVGPMIAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEW
LLRRIFRTGAHTRGWFVGRKRRRARKQTEQALLKLAEGDYQQVEKLMAKNADHAEQPVVN
YLLAAEAAQQRGDEARANQHLERAAELAGNDTIPVEITRVRLQLARNENHAARHGVDKLL
EVTPRHPEVLRLAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQAR
ADNGSEGLRNWWKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLL
PIPRLKTNNPEQLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPD
AYDYAWLADALDRLHKPEEAAAMRRDGLMLTLQNHPPQ
Download sequence
Identical sequences A0A0E0Y5W1 A0A222QTM9 A0A2H3M0H9 B7L958
585055.EC55989_4272 gi|410485016|ref|YP_006772562.1| gi|407484470|ref|YP_006781620.1| gi|407466805|ref|YP_006786753.1| WP_000921790.1.100499 WP_000921790.1.10080 WP_000921790.1.101359 WP_000921790.1.101845 WP_000921790.1.12344 WP_000921790.1.17172 WP_000921790.1.19147 WP_000921790.1.19581 WP_000921790.1.20159 WP_000921790.1.23393 WP_000921790.1.24575 WP_000921790.1.26270 WP_000921790.1.2642 WP_000921790.1.26613 WP_000921790.1.27060 WP_000921790.1.27856 WP_000921790.1.28683 WP_000921790.1.33341 WP_000921790.1.35465 WP_000921790.1.36042 WP_000921790.1.36812 WP_000921790.1.36975 WP_000921790.1.39690 WP_000921790.1.41752 WP_000921790.1.43137 WP_000921790.1.43177 WP_000921790.1.44029 WP_000921790.1.4449 WP_000921790.1.46616 WP_000921790.1.47050 WP_000921790.1.4857 WP_000921790.1.49124 WP_000921790.1.49774 WP_000921790.1.49954 WP_000921790.1.50418 WP_000921790.1.52691 WP_000921790.1.532 WP_000921790.1.5342 WP_000921790.1.54023 WP_000921790.1.55417 WP_000921790.1.5561 WP_000921790.1.55787 WP_000921790.1.56149 WP_000921790.1.56689 WP_000921790.1.58507 WP_000921790.1.60325 WP_000921790.1.62762 WP_000921790.1.63556 WP_000921790.1.654 WP_000921790.1.67383 WP_000921790.1.73908 WP_000921790.1.74735 WP_000921790.1.75021 WP_000921790.1.76656 WP_000921790.1.77162 WP_000921790.1.77462 WP_000921790.1.78445 WP_000921790.1.79067 WP_000921790.1.81026 WP_000921790.1.81580 WP_000921790.1.86210 WP_000921790.1.91290 WP_000921790.1.94808 WP_000921790.1.96341 WP_000921790.1.9661 WP_000921790.1.96944 WP_000921790.1.99046 WP_000921790.1.99304 WP_000921790.1.99592 YP_006781620.1.12065 gi|218697516|ref|YP_002405183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]