SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000961558.1.40598 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000961558.1.40598
Domain Number 1 Region: 213-400
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.28e-67
Family B3/B4 domain of PheRS, PheT 0.00000859
Further Details:      
 
Domain Number 2 Region: 472-694
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.97e-48
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00018
Further Details:      
 
Domain Number 3 Region: 37-196
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.57e-43
Family Myf domain 0.0037
Further Details:      
 
Domain Number 4 Region: 704-801
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.44e-29
Family Anticodon-binding domain of PheRS 0.00085
Further Details:      
 
Domain Number 5 Region: 411-480
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.01e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000961558.1.40598
Sequence length 801
Comment phenylalanine--tRNA ligase subunit beta [Streptococcus oralis]; AA=GCF_000253155.1; RF=na; TAX=927666; STAX=1303; NAME=Streptococcus oralis Uo5; strain=Uo5; AL=Complete Genome; RT=Major
Sequence
MLVSYKWLKELVDIDVPSQELAEKMSTTGIEVEGVESSAAGLSKIVVGEVLSCEDVPETH
LHVCQVNVGEEEARQIVCGAPNVRAGIKVMVALPGARIADNYKIKKGKIRGLESLGMICS
LGELGISDSVVPKEFADGIQILPEDAVPGEEVFSYLDLDDEIIELSITPNRADALSMRGV
AYEVAAIYDKAVSFKEFSLSETDQAAADALSVGIETDKAPYYAARILDNVTIAPSPQWLQ
NLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDTFEGTDIRVREARAGEKLVTLDGEE
RDLEANDLVITVADKPVALAGVMGGQATEISENSSRVVLEAAVFNGKSIRKTSGRLNLRS
ESSSRFEKGINVATVNEALDAAASMIADLAGATVRKGIVSAGELDTSDVEVSSTLADVNR
VLGTELSYADVEDVFRRLGFGLSGNAESFTVSVPRRRWDITIEADLFEEIARIYGYDRLP
TSLPKDDGTAGELTATQKLRRQVRTIAEGAGLTEIITYALTTPEKAVEFTAQPSNLTELM
WPMTVDRSVLRQNMVSGILDTVAYNVARKNKNLALYEIGKVFEQTGNPKEELPNEINSFA
FALTGLVAEKDFQTAAVPVDFFYAKGILEALFDRLGLEVTYTATAEIASLHPGRTAVISL
GDQVLGFLGQVHPVTAKAYDIPETYVAELNLSAIEAALQPAAPFVEITKFPAVSRDMALL
LKAEVTHQEVVDAIQAAGVKRLTDIKLFDVFSGEKLGVGMKSMAYSLTFQNPEDSLTDEE
VARYMEKIQASLEEKVNAEVR
Download sequence
Identical sequences F2QGV8
gi|331265680|ref|YP_004325310.1| WP_000961558.1.40598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]