SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000961592.1.21525 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000961592.1.21525
Domain Number 1 Region: 210-400
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.63e-67
Family B3/B4 domain of PheRS, PheT 0.0000112
Further Details:      
 
Domain Number 2 Region: 472-693
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.44e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00013
Further Details:      
 
Domain Number 3 Region: 36-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.57e-42
Family Myf domain 0.0037
Further Details:      
 
Domain Number 4 Region: 703-801
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.58e-30
Family Anticodon-binding domain of PheRS 0.00065
Further Details:      
 
Domain Number 5 Region: 408-480
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 6.04e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000961592.1.21525
Sequence length 801
Comment MULTISPECIES: phenylalanine--tRNA ligase subunit beta [Streptococcus]; AA=GCF_000310985.1; RF=na; TAX=1105242; STAX=1311; NAME=Streptococcus agalactiae str. Gottschalk 999B; strain=Gottschalk 999B; AL=Contig; RT=Major
Sequence
MLVSYKWLKELVDVDVTTAELAEKMSTTGIEVEGVETPAEGLSKLVVGHIVSCEDVPDTY
LHLCQVDTGDDELRQVVCGAPNVKTGINVIVAVPGARIADNYKIKKGKIRGMESLGMICS
LQELGLSESIIPKEFSDGIQILPEGAIPGDSIFSYLDLDDEIIELSITPNRADALSMRGV
AHEVAAIYGKKVHFEEKNLIEEAERAADKISVVIESDKVLSYSARIVKNVTVAPSPQWLQ
NKLMNAGIRPINNVVDVTNYVLLTYGQPMHAFDFDKFDGTTIVARNAENGEKLITLDGEE
RDLIADDLVIAVNDQPVALAGVMGGQSTEIGSSSKTVVLEAAVFNGTSIRKTSGRLNLRS
ESSSRFEKGINYDTVSEAMDFAAAMLQELAGGQVLSGQVTEGVLPTEPVEVSTTLGYVNT
RLGTELTYTDIEEVFEKLGFAISGSEVKFTVLVPRRRWDIAIQADLVEEIARIYGYEKLP
TTLPEAGATAGELTSMQRLRRRVRTVAEGAGLSEIITYALTTPEKAVQFSTQATNITELM
WPMTVDRSALRQNVVSGMLDTIAYNVARKNSNLAVYEIGKVFEQTGNPKEDLPTEVETFT
FALTGLVEEKDFQTKAKPVDFFYAKGIVEALFIKLKLDVTFVAQKGLASMHPGRTATILL
DGKEIGFVGQVHPQTAKQYDIPETYVAEINLSTIESQMNQALIFEDITKYPSVSRDIALL
LAESVSHHDIVSAIETSGVKRLTAIKLFDVYAGNNIAEGYKSMAYSLTFQNPNDNLTDEE
VAKYMEKITKSLVEKVNAEIR
Download sequence
Identical sequences A0A2I2AGN0 Q3K1I7
WP_000961592.1.100367 WP_000961592.1.100766 WP_000961592.1.101222 WP_000961592.1.101267 WP_000961592.1.10371 WP_000961592.1.12166 WP_000961592.1.12688 WP_000961592.1.12755 WP_000961592.1.12978 WP_000961592.1.13064 WP_000961592.1.1437 WP_000961592.1.15526 WP_000961592.1.16535 WP_000961592.1.1760 WP_000961592.1.18450 WP_000961592.1.18841 WP_000961592.1.19892 WP_000961592.1.20188 WP_000961592.1.21525 WP_000961592.1.22004 WP_000961592.1.23380 WP_000961592.1.24441 WP_000961592.1.24475 WP_000961592.1.26791 WP_000961592.1.27880 WP_000961592.1.29163 WP_000961592.1.29238 WP_000961592.1.30703 WP_000961592.1.30710 WP_000961592.1.31888 WP_000961592.1.32728 WP_000961592.1.34467 WP_000961592.1.34475 WP_000961592.1.34906 WP_000961592.1.36095 WP_000961592.1.36408 WP_000961592.1.36878 WP_000961592.1.38699 WP_000961592.1.39386 WP_000961592.1.3963 WP_000961592.1.41399 WP_000961592.1.41663 WP_000961592.1.41785 WP_000961592.1.42844 WP_000961592.1.44727 WP_000961592.1.44746 WP_000961592.1.45 WP_000961592.1.45103 WP_000961592.1.45150 WP_000961592.1.45976 WP_000961592.1.47485 WP_000961592.1.48239 WP_000961592.1.5055 WP_000961592.1.51114 WP_000961592.1.51780 WP_000961592.1.52470 WP_000961592.1.54818 WP_000961592.1.56404 WP_000961592.1.56602 WP_000961592.1.56930 WP_000961592.1.57721 WP_000961592.1.57900 WP_000961592.1.59565 WP_000961592.1.5977 WP_000961592.1.61790 WP_000961592.1.62362 WP_000961592.1.63764 WP_000961592.1.64713 WP_000961592.1.65323 WP_000961592.1.67008 WP_000961592.1.68827 WP_000961592.1.69023 WP_000961592.1.69101 WP_000961592.1.69132 WP_000961592.1.70397 WP_000961592.1.71554 WP_000961592.1.75293 WP_000961592.1.76610 WP_000961592.1.79135 WP_000961592.1.80180 WP_000961592.1.81115 WP_000961592.1.81168 WP_000961592.1.81506 WP_000961592.1.8340 WP_000961592.1.83616 WP_000961592.1.84119 WP_000961592.1.84227 WP_000961592.1.85179 WP_000961592.1.852 WP_000961592.1.87033 WP_000961592.1.87307 WP_000961592.1.87395 WP_000961592.1.87882 WP_000961592.1.887 WP_000961592.1.89248 WP_000961592.1.89303 WP_000961592.1.90411 WP_000961592.1.90530 WP_000961592.1.90666 WP_000961592.1.90941 WP_000961592.1.91002 WP_000961592.1.933 WP_000961592.1.9386 WP_000961592.1.94370 WP_000961592.1.95950 WP_000961592.1.96943 WP_000961592.1.97850 WP_000961592.1.99241 gi|76786957|ref|YP_329616.1| gi|406709360|ref|YP_006764086.1| 205921.SAK_0994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]