SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000970324.1.74915 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000970324.1.74915
Domain Number 1 Region: 95-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000732
Family NfeD domain-like 0.0089
Further Details:      
 
Weak hits

Sequence:  WP_000970324.1.74915
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000497
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000970324.1.74915
Sequence length 152
Comment MULTISPECIES: NfeD family protein [Enterobacteriaceae]; AA=GCF_002244465.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=31-679; AL=Scaffold; RT=Major
Sequence
MMELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMF
AILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLGAGTHVEVIAIEGITLIIRAVIA
Download sequence
Identical sequences A0A029IAK6 A0A029J1B9 A0A0H2V713 A0A0J2DQ31 A0A1E2VP33 A0A1X3J683 B1LJQ1 D6I7K9 D8AFC4 F4TB18 S0Y2B6 S0ZAJ3 T6MAF9 T9T481 U9Y8X6 V0SF21 V0X3X8
gi|386628079|ref|YP_006147799.1| gi|386637905|ref|YP_006104703.1| 199310.c0609 439855.EcSMS35_0537 gi|26246504|ref|NP_752543.1| WP_000970324.1.100306 WP_000970324.1.101110 WP_000970324.1.10138 WP_000970324.1.101693 WP_000970324.1.101727 WP_000970324.1.101977 WP_000970324.1.101984 WP_000970324.1.102076 WP_000970324.1.102106 WP_000970324.1.10786 WP_000970324.1.10869 WP_000970324.1.11068 WP_000970324.1.11285 WP_000970324.1.11399 WP_000970324.1.11411 WP_000970324.1.11575 WP_000970324.1.12268 WP_000970324.1.12295 WP_000970324.1.12352 WP_000970324.1.12679 WP_000970324.1.1278 WP_000970324.1.12826 WP_000970324.1.13272 WP_000970324.1.13626 WP_000970324.1.13778 WP_000970324.1.14245 WP_000970324.1.14371 WP_000970324.1.14687 WP_000970324.1.14914 WP_000970324.1.15420 WP_000970324.1.15731 WP_000970324.1.16608 WP_000970324.1.16705 WP_000970324.1.16979 WP_000970324.1.17325 WP_000970324.1.17757 WP_000970324.1.17849 WP_000970324.1.18118 WP_000970324.1.18908 WP_000970324.1.19036 WP_000970324.1.19171 WP_000970324.1.1960 WP_000970324.1.19661 WP_000970324.1.19761 WP_000970324.1.19972 WP_000970324.1.20765 WP_000970324.1.20784 WP_000970324.1.20933 WP_000970324.1.20962 WP_000970324.1.21614 WP_000970324.1.21756 WP_000970324.1.22088 WP_000970324.1.22280 WP_000970324.1.22293 WP_000970324.1.22508 WP_000970324.1.22667 WP_000970324.1.23282 WP_000970324.1.23330 WP_000970324.1.23435 WP_000970324.1.23700 WP_000970324.1.23724 WP_000970324.1.23985 WP_000970324.1.24088 WP_000970324.1.24177 WP_000970324.1.24634 WP_000970324.1.24797 WP_000970324.1.2502 WP_000970324.1.25248 WP_000970324.1.25612 WP_000970324.1.25680 WP_000970324.1.2597 WP_000970324.1.26175 WP_000970324.1.26284 WP_000970324.1.26398 WP_000970324.1.26579 WP_000970324.1.26837 WP_000970324.1.2700 WP_000970324.1.27188 WP_000970324.1.27797 WP_000970324.1.27871 WP_000970324.1.28345 WP_000970324.1.28723 WP_000970324.1.28863 WP_000970324.1.28924 WP_000970324.1.29164 WP_000970324.1.29258 WP_000970324.1.29429 WP_000970324.1.29603 WP_000970324.1.2963 WP_000970324.1.29647 WP_000970324.1.29819 WP_000970324.1.29855 WP_000970324.1.30400 WP_000970324.1.309 WP_000970324.1.31154 WP_000970324.1.31433 WP_000970324.1.3201 WP_000970324.1.32478 WP_000970324.1.32518 WP_000970324.1.32650 WP_000970324.1.32748 WP_000970324.1.33046 WP_000970324.1.33190 WP_000970324.1.33476 WP_000970324.1.34208 WP_000970324.1.34362 WP_000970324.1.3439 WP_000970324.1.35107 WP_000970324.1.3515 WP_000970324.1.35253 WP_000970324.1.35394 WP_000970324.1.35483 WP_000970324.1.35578 WP_000970324.1.35741 WP_000970324.1.35889 WP_000970324.1.36459 WP_000970324.1.36699 WP_000970324.1.37032 WP_000970324.1.37312 WP_000970324.1.37477 WP_000970324.1.37608 WP_000970324.1.38185 WP_000970324.1.39313 WP_000970324.1.39651 WP_000970324.1.39734 WP_000970324.1.40019 WP_000970324.1.40083 WP_000970324.1.40153 WP_000970324.1.40349 WP_000970324.1.40486 WP_000970324.1.40842 WP_000970324.1.40843 WP_000970324.1.41041 WP_000970324.1.41063 WP_000970324.1.41078 WP_000970324.1.41332 WP_000970324.1.42600 WP_000970324.1.42677 WP_000970324.1.42771 WP_000970324.1.43027 WP_000970324.1.43427 WP_000970324.1.43942 WP_000970324.1.44327 WP_000970324.1.44447 WP_000970324.1.4459 WP_000970324.1.44717 WP_000970324.1.44759 WP_000970324.1.44784 WP_000970324.1.45190 WP_000970324.1.4530 WP_000970324.1.45525 WP_000970324.1.45789 WP_000970324.1.45801 WP_000970324.1.45891 WP_000970324.1.46438 WP_000970324.1.4647 WP_000970324.1.46795 WP_000970324.1.46994 WP_000970324.1.47024 WP_000970324.1.47047 WP_000970324.1.47189 WP_000970324.1.47235 WP_000970324.1.47344 WP_000970324.1.47349 WP_000970324.1.47366 WP_000970324.1.47454 WP_000970324.1.48431 WP_000970324.1.48910 WP_000970324.1.49170 WP_000970324.1.49179 WP_000970324.1.49483 WP_000970324.1.50228 WP_000970324.1.50278 WP_000970324.1.50947 WP_000970324.1.511 WP_000970324.1.51426 WP_000970324.1.51690 WP_000970324.1.52085 WP_000970324.1.53021 WP_000970324.1.53687 WP_000970324.1.53810 WP_000970324.1.5393 WP_000970324.1.54188 WP_000970324.1.54208 WP_000970324.1.5434 WP_000970324.1.54534 WP_000970324.1.54590 WP_000970324.1.54754 WP_000970324.1.5478 WP_000970324.1.54993 WP_000970324.1.55359 WP_000970324.1.55563 WP_000970324.1.55731 WP_000970324.1.55790 WP_000970324.1.55808 WP_000970324.1.56122 WP_000970324.1.56501 WP_000970324.1.56502 WP_000970324.1.56941 WP_000970324.1.57266 WP_000970324.1.57492 WP_000970324.1.57608 WP_000970324.1.57832 WP_000970324.1.58233 WP_000970324.1.58345 WP_000970324.1.58692 WP_000970324.1.58737 WP_000970324.1.59060 WP_000970324.1.59483 WP_000970324.1.59815 WP_000970324.1.59970 WP_000970324.1.615 WP_000970324.1.62043 WP_000970324.1.62091 WP_000970324.1.62481 WP_000970324.1.62555 WP_000970324.1.62586 WP_000970324.1.63310 WP_000970324.1.63419 WP_000970324.1.63465 WP_000970324.1.6348 WP_000970324.1.64138 WP_000970324.1.64180 WP_000970324.1.643 WP_000970324.1.64547 WP_000970324.1.6500 WP_000970324.1.65104 WP_000970324.1.6527 WP_000970324.1.65957 WP_000970324.1.65991 WP_000970324.1.6666 WP_000970324.1.66706 WP_000970324.1.67132 WP_000970324.1.67164 WP_000970324.1.67669 WP_000970324.1.68052 WP_000970324.1.68873 WP_000970324.1.69341 WP_000970324.1.69382 WP_000970324.1.69438 WP_000970324.1.69450 WP_000970324.1.69569 WP_000970324.1.69655 WP_000970324.1.697 WP_000970324.1.69832 WP_000970324.1.69872 WP_000970324.1.69963 WP_000970324.1.701 WP_000970324.1.7015 WP_000970324.1.70230 WP_000970324.1.7102 WP_000970324.1.71287 WP_000970324.1.71712 WP_000970324.1.71912 WP_000970324.1.71967 WP_000970324.1.72117 WP_000970324.1.723 WP_000970324.1.72425 WP_000970324.1.72551 WP_000970324.1.72599 WP_000970324.1.74032 WP_000970324.1.74041 WP_000970324.1.74185 WP_000970324.1.74358 WP_000970324.1.74549 WP_000970324.1.74915 WP_000970324.1.75118 WP_000970324.1.75922 WP_000970324.1.76019 WP_000970324.1.76237 WP_000970324.1.76268 WP_000970324.1.76269 WP_000970324.1.76504 WP_000970324.1.76660 WP_000970324.1.77036 WP_000970324.1.77326 WP_000970324.1.77643 WP_000970324.1.77657 WP_000970324.1.77816 WP_000970324.1.78101 WP_000970324.1.78232 WP_000970324.1.78512 WP_000970324.1.78689 WP_000970324.1.79001 WP_000970324.1.79100 WP_000970324.1.79409 WP_000970324.1.80063 WP_000970324.1.80519 WP_000970324.1.80660 WP_000970324.1.80948 WP_000970324.1.81098 WP_000970324.1.81266 WP_000970324.1.81323 WP_000970324.1.814 WP_000970324.1.82104 WP_000970324.1.82221 WP_000970324.1.82682 WP_000970324.1.82901 WP_000970324.1.83238 WP_000970324.1.83256 WP_000970324.1.83644 WP_000970324.1.83706 WP_000970324.1.8405 WP_000970324.1.84948 WP_000970324.1.85025 WP_000970324.1.85125 WP_000970324.1.85252 WP_000970324.1.85554 WP_000970324.1.85578 WP_000970324.1.85593 WP_000970324.1.85781 WP_000970324.1.86227 WP_000970324.1.86234 WP_000970324.1.86273 WP_000970324.1.8656 WP_000970324.1.86560 WP_000970324.1.86613 WP_000970324.1.86753 WP_000970324.1.87766 WP_000970324.1.88082 WP_000970324.1.88767 WP_000970324.1.88793 WP_000970324.1.88826 WP_000970324.1.89043 WP_000970324.1.89069 WP_000970324.1.89285 WP_000970324.1.89396 WP_000970324.1.89469 WP_000970324.1.902 WP_000970324.1.90357 WP_000970324.1.90905 WP_000970324.1.90996 WP_000970324.1.91566 WP_000970324.1.91756 WP_000970324.1.9199 WP_000970324.1.92025 WP_000970324.1.9209 WP_000970324.1.92305 WP_000970324.1.92638 WP_000970324.1.92767 WP_000970324.1.93139 WP_000970324.1.93461 WP_000970324.1.93765 WP_000970324.1.94040 WP_000970324.1.9474 WP_000970324.1.94869 WP_000970324.1.95084 WP_000970324.1.95398 WP_000970324.1.95628 WP_000970324.1.96558 WP_000970324.1.96762 WP_000970324.1.9682 WP_000970324.1.97292 WP_000970324.1.98251 WP_000970324.1.98757 WP_000970324.1.99060 WP_000970324.1.99571 WP_000970324.1.99694 gi|386632999|ref|YP_006152718.1| gi|170680890|ref|YP_001742638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]