SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999917.1.39146 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999917.1.39146
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.23e-40
Family Frataxin-like 0.000000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000999917.1.39146
Sequence length 106
Comment iron donor protein CyaY [Salmonella enterica]; AA=GCF_002046365.1; RF=na; TAX=940231; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Edinburgh; strain=95-0382; AL=Contig; RT=Major
Sequence
MNDSEFHRLADALWLTIEEHLDNWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGEAVSFR
Download sequence
Identical sequences A0A1C3A0L4 A0A1J4R7D2 A0A1Z3Q9B0
ABEH02000008|CDS_52252-51932 WP_000999917.1.100714 WP_000999917.1.101776 WP_000999917.1.11479 WP_000999917.1.11603 WP_000999917.1.14011 WP_000999917.1.15795 WP_000999917.1.16817 WP_000999917.1.18103 WP_000999917.1.18489 WP_000999917.1.20349 WP_000999917.1.20364 WP_000999917.1.20760 WP_000999917.1.20767 WP_000999917.1.2130 WP_000999917.1.21730 WP_000999917.1.22388 WP_000999917.1.2283 WP_000999917.1.23201 WP_000999917.1.23409 WP_000999917.1.23444 WP_000999917.1.24303 WP_000999917.1.24450 WP_000999917.1.25229 WP_000999917.1.26563 WP_000999917.1.2667 WP_000999917.1.26758 WP_000999917.1.27055 WP_000999917.1.27122 WP_000999917.1.28116 WP_000999917.1.29265 WP_000999917.1.30635 WP_000999917.1.30934 WP_000999917.1.31262 WP_000999917.1.3310 WP_000999917.1.34184 WP_000999917.1.35035 WP_000999917.1.35075 WP_000999917.1.35809 WP_000999917.1.36425 WP_000999917.1.36592 WP_000999917.1.36652 WP_000999917.1.36792 WP_000999917.1.3688 WP_000999917.1.37363 WP_000999917.1.37719 WP_000999917.1.38797 WP_000999917.1.38857 WP_000999917.1.39075 WP_000999917.1.39146 WP_000999917.1.39183 WP_000999917.1.40008 WP_000999917.1.40205 WP_000999917.1.40583 WP_000999917.1.41994 WP_000999917.1.42978 WP_000999917.1.4332 WP_000999917.1.4422 WP_000999917.1.44380 WP_000999917.1.45251 WP_000999917.1.45268 WP_000999917.1.47014 WP_000999917.1.47058 WP_000999917.1.49358 WP_000999917.1.49443 WP_000999917.1.49778 WP_000999917.1.50238 WP_000999917.1.50893 WP_000999917.1.52675 WP_000999917.1.5273 WP_000999917.1.54324 WP_000999917.1.5459 WP_000999917.1.55361 WP_000999917.1.55680 WP_000999917.1.56152 WP_000999917.1.57710 WP_000999917.1.57778 WP_000999917.1.58633 WP_000999917.1.59012 WP_000999917.1.59295 WP_000999917.1.60851 WP_000999917.1.60857 WP_000999917.1.61667 WP_000999917.1.63633 WP_000999917.1.65295 WP_000999917.1.65538 WP_000999917.1.66082 WP_000999917.1.66250 WP_000999917.1.66702 WP_000999917.1.66800 WP_000999917.1.67405 WP_000999917.1.68167 WP_000999917.1.6858 WP_000999917.1.68629 WP_000999917.1.6883 WP_000999917.1.6905 WP_000999917.1.69139 WP_000999917.1.71150 WP_000999917.1.71667 WP_000999917.1.72671 WP_000999917.1.73965 WP_000999917.1.74632 WP_000999917.1.75134 WP_000999917.1.7655 WP_000999917.1.7657 WP_000999917.1.77761 WP_000999917.1.78180 WP_000999917.1.78366 WP_000999917.1.79189 WP_000999917.1.79778 WP_000999917.1.80229 WP_000999917.1.80333 WP_000999917.1.80707 WP_000999917.1.80723 WP_000999917.1.81062 WP_000999917.1.81107 WP_000999917.1.8127 WP_000999917.1.82352 WP_000999917.1.82637 WP_000999917.1.82899 WP_000999917.1.83247 WP_000999917.1.83388 WP_000999917.1.84198 WP_000999917.1.84229 WP_000999917.1.850 WP_000999917.1.85031 WP_000999917.1.86206 WP_000999917.1.86442 WP_000999917.1.86676 WP_000999917.1.86921 WP_000999917.1.88483 WP_000999917.1.88776 WP_000999917.1.91023 WP_000999917.1.91473 WP_000999917.1.92039 WP_000999917.1.92149 WP_000999917.1.92883 WP_000999917.1.93648 WP_000999917.1.9463 WP_000999917.1.94971 WP_000999917.1.9627 WP_000999917.1.99637 gi|452122278|ref|YP_007472526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]