SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999921.1.53694 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999921.1.53694
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.06e-40
Family Frataxin-like 0.000000883
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000999921.1.53694
Sequence length 106
Comment iron donor protein CyaY [Salmonella enterica]; AA=GCF_000272955.1; RF=na; TAX=858311; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Newport str. CVM 19593; strain=CVM 19593; AL=Contig; RT=Major
Sequence
MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKDDEWVCDRSGETFWDLLEQAATQQAGEKVSFR
Download sequence
Identical sequences A0A0R9PBJ2 A0A242UYD0 A0A2C6ELL1 A0A2I6P9N4 B4SZ48
423368.SNSL254_A4222 gi|528821493|ref|YP_008362696.1| WP_000999921.1.100165 WP_000999921.1.100413 WP_000999921.1.100502 WP_000999921.1.100521 WP_000999921.1.100650 WP_000999921.1.100711 WP_000999921.1.10675 WP_000999921.1.11362 WP_000999921.1.11405 WP_000999921.1.11544 WP_000999921.1.12160 WP_000999921.1.13101 WP_000999921.1.1326 WP_000999921.1.13819 WP_000999921.1.14505 WP_000999921.1.14706 WP_000999921.1.15483 WP_000999921.1.15625 WP_000999921.1.15644 WP_000999921.1.15708 WP_000999921.1.15881 WP_000999921.1.16166 WP_000999921.1.16331 WP_000999921.1.16941 WP_000999921.1.16944 WP_000999921.1.17285 WP_000999921.1.1737 WP_000999921.1.17447 WP_000999921.1.17991 WP_000999921.1.1807 WP_000999921.1.1897 WP_000999921.1.19055 WP_000999921.1.19823 WP_000999921.1.20391 WP_000999921.1.20425 WP_000999921.1.20573 WP_000999921.1.20695 WP_000999921.1.20894 WP_000999921.1.2101 WP_000999921.1.21086 WP_000999921.1.21165 WP_000999921.1.21750 WP_000999921.1.21792 WP_000999921.1.22315 WP_000999921.1.22453 WP_000999921.1.22514 WP_000999921.1.22575 WP_000999921.1.22582 WP_000999921.1.22604 WP_000999921.1.23010 WP_000999921.1.23485 WP_000999921.1.23587 WP_000999921.1.23621 WP_000999921.1.23629 WP_000999921.1.23736 WP_000999921.1.23755 WP_000999921.1.24158 WP_000999921.1.24163 WP_000999921.1.24433 WP_000999921.1.24567 WP_000999921.1.24873 WP_000999921.1.25498 WP_000999921.1.2554 WP_000999921.1.25722 WP_000999921.1.26093 WP_000999921.1.26129 WP_000999921.1.26224 WP_000999921.1.26269 WP_000999921.1.26363 WP_000999921.1.26426 WP_000999921.1.26576 WP_000999921.1.26646 WP_000999921.1.26709 WP_000999921.1.27419 WP_000999921.1.27713 WP_000999921.1.28612 WP_000999921.1.29099 WP_000999921.1.29190 WP_000999921.1.29255 WP_000999921.1.29924 WP_000999921.1.30086 WP_000999921.1.30909 WP_000999921.1.31210 WP_000999921.1.31476 WP_000999921.1.31782 WP_000999921.1.31952 WP_000999921.1.32750 WP_000999921.1.32900 WP_000999921.1.33392 WP_000999921.1.33825 WP_000999921.1.34330 WP_000999921.1.3476 WP_000999921.1.35460 WP_000999921.1.36157 WP_000999921.1.36232 WP_000999921.1.36751 WP_000999921.1.37063 WP_000999921.1.37558 WP_000999921.1.37848 WP_000999921.1.38199 WP_000999921.1.38341 WP_000999921.1.38408 WP_000999921.1.39466 WP_000999921.1.39722 WP_000999921.1.40155 WP_000999921.1.40171 WP_000999921.1.40508 WP_000999921.1.41225 WP_000999921.1.41375 WP_000999921.1.42797 WP_000999921.1.42829 WP_000999921.1.42887 WP_000999921.1.43086 WP_000999921.1.43160 WP_000999921.1.43476 WP_000999921.1.43875 WP_000999921.1.4404 WP_000999921.1.4405 WP_000999921.1.44438 WP_000999921.1.44440 WP_000999921.1.44791 WP_000999921.1.45138 WP_000999921.1.45351 WP_000999921.1.46091 WP_000999921.1.46250 WP_000999921.1.46322 WP_000999921.1.46730 WP_000999921.1.46961 WP_000999921.1.47389 WP_000999921.1.4769 WP_000999921.1.47714 WP_000999921.1.48244 WP_000999921.1.48399 WP_000999921.1.48493 WP_000999921.1.48896 WP_000999921.1.49102 WP_000999921.1.49226 WP_000999921.1.49233 WP_000999921.1.49595 WP_000999921.1.49630 WP_000999921.1.49931 WP_000999921.1.50007 WP_000999921.1.5009 WP_000999921.1.51162 WP_000999921.1.5138 WP_000999921.1.51414 WP_000999921.1.51611 WP_000999921.1.52446 WP_000999921.1.52637 WP_000999921.1.52738 WP_000999921.1.53206 WP_000999921.1.53694 WP_000999921.1.53790 WP_000999921.1.54061 WP_000999921.1.54082 WP_000999921.1.54085 WP_000999921.1.5517 WP_000999921.1.55223 WP_000999921.1.5552 WP_000999921.1.55528 WP_000999921.1.55995 WP_000999921.1.56247 WP_000999921.1.5633 WP_000999921.1.56393 WP_000999921.1.56396 WP_000999921.1.56824 WP_000999921.1.57149 WP_000999921.1.57357 WP_000999921.1.57641 WP_000999921.1.58249 WP_000999921.1.58301 WP_000999921.1.58564 WP_000999921.1.58744 WP_000999921.1.58932 WP_000999921.1.59928 WP_000999921.1.60004 WP_000999921.1.60746 WP_000999921.1.60838 WP_000999921.1.61233 WP_000999921.1.61519 WP_000999921.1.6210 WP_000999921.1.63043 WP_000999921.1.63129 WP_000999921.1.63234 WP_000999921.1.63250 WP_000999921.1.63422 WP_000999921.1.63731 WP_000999921.1.63824 WP_000999921.1.6399 WP_000999921.1.63992 WP_000999921.1.64072 WP_000999921.1.64217 WP_000999921.1.64242 WP_000999921.1.64412 WP_000999921.1.65508 WP_000999921.1.65838 WP_000999921.1.66167 WP_000999921.1.66534 WP_000999921.1.66600 WP_000999921.1.66630 WP_000999921.1.6692 WP_000999921.1.67184 WP_000999921.1.67374 WP_000999921.1.6833 WP_000999921.1.6857 WP_000999921.1.68658 WP_000999921.1.68818 WP_000999921.1.68966 WP_000999921.1.69029 WP_000999921.1.6907 WP_000999921.1.69288 WP_000999921.1.69787 WP_000999921.1.69890 WP_000999921.1.69977 WP_000999921.1.70028 WP_000999921.1.7014 WP_000999921.1.70326 WP_000999921.1.70523 WP_000999921.1.70547 WP_000999921.1.71481 WP_000999921.1.72119 WP_000999921.1.72234 WP_000999921.1.72629 WP_000999921.1.72850 WP_000999921.1.72897 WP_000999921.1.73144 WP_000999921.1.73804 WP_000999921.1.74402 WP_000999921.1.74414 WP_000999921.1.74481 WP_000999921.1.74996 WP_000999921.1.75793 WP_000999921.1.75828 WP_000999921.1.76208 WP_000999921.1.76738 WP_000999921.1.76866 WP_000999921.1.77017 WP_000999921.1.77543 WP_000999921.1.77565 WP_000999921.1.77871 WP_000999921.1.78 WP_000999921.1.78602 WP_000999921.1.79297 WP_000999921.1.794 WP_000999921.1.79738 WP_000999921.1.7979 WP_000999921.1.7994 WP_000999921.1.79996 WP_000999921.1.80757 WP_000999921.1.81107 WP_000999921.1.81404 WP_000999921.1.81667 WP_000999921.1.81941 WP_000999921.1.82895 WP_000999921.1.82937 WP_000999921.1.82964 WP_000999921.1.83061 WP_000999921.1.83651 WP_000999921.1.83759 WP_000999921.1.84373 WP_000999921.1.84459 WP_000999921.1.84475 WP_000999921.1.84644 WP_000999921.1.85120 WP_000999921.1.85126 WP_000999921.1.8537 WP_000999921.1.85456 WP_000999921.1.8552 WP_000999921.1.85780 WP_000999921.1.86224 WP_000999921.1.86316 WP_000999921.1.86593 WP_000999921.1.86982 WP_000999921.1.87143 WP_000999921.1.87283 WP_000999921.1.87365 WP_000999921.1.8849 WP_000999921.1.89789 WP_000999921.1.89870 WP_000999921.1.90248 WP_000999921.1.90311 WP_000999921.1.90348 WP_000999921.1.90472 WP_000999921.1.90701 WP_000999921.1.90814 WP_000999921.1.90866 WP_000999921.1.9093 WP_000999921.1.91156 WP_000999921.1.91189 WP_000999921.1.91524 WP_000999921.1.92047 WP_000999921.1.92122 WP_000999921.1.92408 WP_000999921.1.92439 WP_000999921.1.92832 WP_000999921.1.93596 WP_000999921.1.93761 WP_000999921.1.94622 WP_000999921.1.9481 WP_000999921.1.94817 WP_000999921.1.9516 WP_000999921.1.95703 WP_000999921.1.96172 WP_000999921.1.96260 WP_000999921.1.96798 WP_000999921.1.97640 WP_000999921.1.97726 WP_000999921.1.97800 WP_000999921.1.97907 WP_000999921.1.98124 WP_000999921.1.98513 WP_000999921.1.98627 WP_000999921.1.99072 WP_000999921.1.99469 WP_000999921.1.99561 WP_000999921.1.99725 CP001113|CDS_4115621-4115301 gi|194443389|ref|YP_002043174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]