SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999922.1.84693 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999922.1.84693
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.19e-40
Family Frataxin-like 0.000000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000999922.1.84693
Sequence length 106
Comment iron donor protein CyaY [Salmonella enterica]; AA=GCF_001479385.1; RF=na; TAX=90105; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Saintpaul; strain=CVM N32053; AL=Contig; RT=Major
Sequence
MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKDDEWVCDRSGETFWELLEQAATQQAGEKVSFR
Download sequence
Identical sequences A0A0W3SIB6 A0A249V4T0
WP_000999922.1.100258 WP_000999922.1.101320 WP_000999922.1.11000 WP_000999922.1.12025 WP_000999922.1.13334 WP_000999922.1.15079 WP_000999922.1.15909 WP_000999922.1.167 WP_000999922.1.17747 WP_000999922.1.18282 WP_000999922.1.19240 WP_000999922.1.19642 WP_000999922.1.20330 WP_000999922.1.21548 WP_000999922.1.22537 WP_000999922.1.25206 WP_000999922.1.28126 WP_000999922.1.31219 WP_000999922.1.3127 WP_000999922.1.32527 WP_000999922.1.32860 WP_000999922.1.34977 WP_000999922.1.35429 WP_000999922.1.37687 WP_000999922.1.3869 WP_000999922.1.39556 WP_000999922.1.41859 WP_000999922.1.43351 WP_000999922.1.44971 WP_000999922.1.45344 WP_000999922.1.45522 WP_000999922.1.45797 WP_000999922.1.46930 WP_000999922.1.47928 WP_000999922.1.49827 WP_000999922.1.5058 WP_000999922.1.50774 WP_000999922.1.52148 WP_000999922.1.53436 WP_000999922.1.542 WP_000999922.1.54273 WP_000999922.1.54827 WP_000999922.1.55993 WP_000999922.1.56597 WP_000999922.1.57232 WP_000999922.1.5854 WP_000999922.1.5953 WP_000999922.1.60052 WP_000999922.1.61609 WP_000999922.1.62570 WP_000999922.1.63063 WP_000999922.1.65572 WP_000999922.1.69754 WP_000999922.1.71407 WP_000999922.1.71691 WP_000999922.1.72372 WP_000999922.1.73062 WP_000999922.1.73164 WP_000999922.1.73561 WP_000999922.1.73667 WP_000999922.1.73926 WP_000999922.1.7394 WP_000999922.1.81410 WP_000999922.1.82584 WP_000999922.1.83365 WP_000999922.1.84693 WP_000999922.1.85855 WP_000999922.1.87219 WP_000999922.1.89940 WP_000999922.1.9131 WP_000999922.1.92060 WP_000999922.1.92171 WP_000999922.1.92318 WP_000999922.1.93275 WP_000999922.1.93376 WP_000999922.1.94987 WP_000999922.1.96497 WP_000999922.1.98763 ABAM02000001|CDS_4518871-4518551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]