SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999924.1.67623 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999924.1.67623
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.57e-39
Family Frataxin-like 0.000000883
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000999924.1.67623
Sequence length 106
Comment iron donor protein CyaY [Salmonella bongori]; AA=GCF_002035265.1; RF=na; TAX=1160722; STAX=54736; NAME=Salmonella bongori serovar 48:z35:-; strain=BCW_1557; AL=Contig; RT=Major
Sequence
MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWVCDRSGATFWHLLEQAATQQAGETVSFR
Download sequence
Identical sequences A0A0K0HGJ9 A0A248KEZ5 S5NLR3
WP_000999924.1.16347 WP_000999924.1.16704 WP_000999924.1.34539 WP_000999924.1.60930 WP_000999924.1.67623 WP_000999924.1.75919 WP_000999924.1.83838 WP_000999924.1.86769 gi|340001394|ref|YP_004732278.1| gi|526229949|ref|YP_008324592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]