SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001092361.1.91404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001092361.1.91404
Domain Number - Region: 35-128
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0133
Family Capz beta-1 subunit 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001092361.1.91404
Sequence length 146
Comment hypothetical protein [Bacillus cereus]; AA=GCF_900176975.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=16-00183; AL=Scaffold; RT=Major
Sequence
MNTINKILSDFADINADEYVSNYYEVSIMSENKKDNIFELAKNATYATSNDILELIRLKE
WKKEFLICQYPNGESSWFGKIPYGYDLNGVTPKEFIIQQLLNVFKQEPDEVYWIKLDPGG
YYACCYEEYLFRTDKGIYFFSMQVHD
Download sequence
Identical sequences A0A151UWR1 A0A243NT66 C2TR00 J8ITB0
WP_001092361.1.100684 WP_001092361.1.10069 WP_001092361.1.101931 WP_001092361.1.11044 WP_001092361.1.13299 WP_001092361.1.16013 WP_001092361.1.24338 WP_001092361.1.29766 WP_001092361.1.29804 WP_001092361.1.43533 WP_001092361.1.45919 WP_001092361.1.46746 WP_001092361.1.50350 WP_001092361.1.58037 WP_001092361.1.63137 WP_001092361.1.66357 WP_001092361.1.6753 WP_001092361.1.73457 WP_001092361.1.77902 WP_001092361.1.81773 WP_001092361.1.8907 WP_001092361.1.91404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]