SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001128818.1.24709 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001128818.1.24709
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.92e-18
Family SinR domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001128818.1.24709
Sequence length 66
Comment MULTISPECIES: transcriptional regulator [Bacillus]; AA=GCF_002147755.1; RF=na; TAX=1042874; STAX=1428; NAME=Bacillus thuringiensis serovar thailandensis; strain=T68001; AL=Scaffold; RT=Major
Sequence
MPLKTRMKEYRVKLSMSQEDLANEVGVRRETIGNLENGKYNPSFKLTYDIAKVLKAPIEV
LFWFEE
Download sequence
Identical sequences A0A0T8YE87 A0A1J9Z1V9 A0A1T2R5Y4 A0A243DUF2 A0A243I850 A0A2A7YWP5 A0A2B8V603 J8DEQ3
WP_001128818.1.101309 WP_001128818.1.10775 WP_001128818.1.24709 WP_001128818.1.39896 WP_001128818.1.4039 WP_001128818.1.41518 WP_001128818.1.45385 WP_001128818.1.46244 WP_001128818.1.58335 WP_001128818.1.65665 WP_001128818.1.66331 WP_001128818.1.71114 WP_001128818.1.73166 WP_001128818.1.73638 WP_001128818.1.82421 WP_001128818.1.82566 WP_001128818.1.90671 WP_001128818.1.94373 gi|296506515|ref|YP_003667749.1|NC_014172 gi|296506515|ref|YP_003667749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]